Identifiers and Description

Gene Model Identifier

Contig19741.0.g51

Standard Name

YBAK1b

Aliases

Contig19741_0_g51

Description

YbaK / prolyl-tRNA synthetases associated domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam04073 ) YbaK / prolyl-tRNA synthetases associated domain
  • ( pfam02204 ) Vacuolar sorting protein 9 (VPS9) domain
  • ( pfam10007 ) Uncharacterized protein conserved in archaea (DUF2250)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001492101.999981404597394e-31YbaK/prolyl-tRNA synthetase-li
ke, putative

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19741.0.g51(coding)
ATGAACACAGCAGCTACAGATACCTAAAAAGATATCGATTTGTCAAACAACGATGAAAAT
GAAGTCGAAGAAAAAGTAGTGTTAAGAGAACTCACAAAAGAAGAGTAAATTACTGAATCA
ATATAGAGCATTCACACTATGCTCACTTTCTTGAAGAGATTGAAAGCGGATCATGGCTTA
AGGTCGATTTAGATGGCTAGAGCGCCCAGGGAGTATTACGCTTGGCGATTATAGGAGAGG
AAGGAATTCTTGGGTGCACCTAGTGAATATGCTCTCTGCAAGACTATCATTATGAAGAAT
AGCGAGTATAATGATGAATACTCCAATGACCCATTCTATCCAAGATTCATTATGGTGATA
GTCCAATACAAAAAGTCCTTAATCTCTCAAAACATTGCGAATATCATGAAAGATTATCAA
AGAAAGCACACCTAATTAAAAGAGATTGGTAAAAAACAATTTAAATACAGACTAGCTGAT
GAAGCTGATGCTTTTGAATTGAGTGGCTACAGTTATAACAGTATTACACCATTCTTTATG
AAAAATGATGAATTGTTGATAATACTCAGTGATGATATCGTAAATCTTAATCCTGGCTAC
TTTTGGCTTGGAGGAGGACGAGTGGAGCTAAAGATTGGTGTCTCAGTTGAAGAGTTCATG
CAATTCTTTGGCGATAGAGTTATTACAGGAAGTATATCAAGAGCTAAATAGGTACCAACT
CATTGA


>Contig19741.0.g51(protein)
MNTAATDTQKDIDLSNNDENEVEEKVVLRELTKEEQITESIQSIHTMLTFLKRLKADHGL
RSIQMARAPREYYAWRLQERKEFLGAPSEYALCKTIIMKNSEYNDEYSNDPFYPRFIMVI
VQYKKSLISQNIANIMKDYQRKHTQLKEIGKKQFKYRLADEADAFELSGYSYNSITPFFM
KNDELLIILSDDIVNLNPGYFWLGGGRVELKIGVSVEEFMQFFGDRVITGSISRAKQVPT
H