Identifiers and Description

Gene Model Identifier

Contig5884.0.g70

Standard Name

YBAK1a

Aliases

Contig5884_0_g70

Description

YbaK / prolyl-tRNA synthetases associated domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam04073 ) YbaK / prolyl-tRNA synthetases associated domain
  • ( pfam02204 ) Vacuolar sorting protein 9 (VPS9) domain
  • ( pfam01250 ) Ribosomal protein S6

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001492102.0008113830639685e-30YbaK/prolyl-tRNA synthetase-li
ke, putative

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5884.0.g70(coding)
ATGAGCACAGCAGCTATCGACGCATAAAAAGATATCGATTTGTCAAACAACGATGAAAAC
GAGGTAGAAGAAAAAGTAGTGTTAAGAGAACTCACAAAAGAAGAGTAAATTACTGAATCT
ATAGAGAGCATTAACACCATGCTCACTTTCTTGAAGAGATTGAAAGTGAATCATGGCTTG
AGATCGATTTAGATGGCTAGAGCCCCGAGAGAGTATTACGCTTGGAGTTTAAAAGAGAGG
AAGGAATTCTTGGGTGCCCCCAGTGAATATGCTCTCTGCAAGACTATCATTATGAAGAAT
AGCGAGTATAATGATGAATACTCCAATGATCCATTCTACCCAAGATTCATAATGGTGATA
GTCCAATACAAAAAGTCCTTAATTTCTCAAAACATTGCAAACATCATGAAAGATTACTAA
AGAAAGCACACTTAATTGAAAGAGATTGGTAAAAAACAATTTAAATACAGACTTGCAGAT
GAGGCTGATGCTTTTGAATTGAGTGGCTACAGTTATAATAGCATCACACCATTCTTTATG
AAAAATGATAAGCTATTAATTATACTCAGTGATGATATAGTAAAACTTAATCCTGGCTAC
TTTTGGCTTGGAGGAGGACGAGTGGAACTTAAGATTGGTGTTTCAGTTGAAGAGTTCATG
CAATTCTTTGGCAACAGAGTTATTACAGGAAGTATATCAAGAGCTAAATAAGTACCTACT
GTTTGA


>Contig5884.0.g70(protein)
MSTAAIDAQKDIDLSNNDENEVEEKVVLRELTKEEQITESIESINTMLTFLKRLKVNHGL
RSIQMARAPREYYAWSLKERKEFLGAPSEYALCKTIIMKNSEYNDEYSNDPFYPRFIMVI
VQYKKSLISQNIANIMKDYQRKHTQLKEIGKKQFKYRLADEADAFELSGYSYNSITPFFM
KNDKLLIILSDDIVKLNPGYFWLGGGRVELKIGVSVEEFMQFFGNRVITGSISRAKQVPT
V