Identifiers and Description

Gene Model Identifier

Contig22340.0.g91

Standard Name

YARS2

Aliases

Contig22340_0_g91

Description

tRNA synthetases class I (W and Y)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00579 ) tRNA synthetases class I (W and Y)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003004709.995094197784295e-101tyrosyl-tRNA synthetase family
protein
SGDYPL097W1.999469658314961e-75MSY1 SGDID:S000006018, Chr XVI
from 364952-366430, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22340.0.g91(coding)
ATGAAGAAATTAGTATCTGGAATATATTCTCAACCATTCAAGCATCTCCATAATAGAAAA
TTGCTTTATTTCGTGTCAAATAACAACTTAAAAGAGTCAAATTAAGAGCAATTATAAAAC
TATTTTCCAGTTTAAGACTCCAGTGTTTACATCGGTTTTGACCCCACTGCGGAAAGCATA
CACTTGGGAAATTATATTGGATTATTAGCACTAACTCATTTCAGATTGGCAGGTTATAAC
CCCATAGTGGTATTTGGAGGAGCTACAGCTCTTATCGGGGATCCAAGTGGCAGAACTACA
GATCGATAATAAATGTTAAAGGGGCAAGTTGAAAATAATCTCCACAAGTTTCAGACATAG
TTCTCTTACTTAACTAAAAACATTGATAATTATATCTCAAGAAACAGCAATAAAATAGAG
GACTTAAAGCAAACTTCAGACATCAAGCCTTATACTTTTGTTAATAATTACACTTTCTAT
GAAGACTTGAATCTTATTAATTTCTTAAGAGATATCGGTGTGCATTTCAGAGTAAACTCA
ATGATATCAAAAGATTCAGTCAAGCAGAGAATTGGAGATTCTAATAAATAAGGAGAAGGC
ATGAGTTTTACAGAATTCACTTACTAAATATTTCAAGGTTATGATTTCTTGAGACTAAGG
CAAGATTACAATTGTAAACTTTAGATTGGAGGAAGCGATTAATGGGGAAATATTGCCTCT
GGTTGTGATCTGATAAGAAGAGTCATGAATGAAGAAGCATATGGAGCTACTATTCCACTA
CTTGTTAATTCTCAAGGAGAGAAATTCGGGAAATCAGCAGGCAACACTGGAGCTATTTGG
TGTGATCCAACAAAAACTGAACCCTACTAGCTTTATCAATTCTTACTTAATGTTACTGAC
TAAGAAGTGGAAGACTTACTCTTGAAGTTAACTTTTATACCTATTGAAGAAATCTAGTAA
ACTATGACACAGCATAACAGTAAACCAGAAAGCAGAATTGCTTAGAAACTTCTTGCCAAA
ACTTTAACTGAAATTATTCATGGTTAAGAAAGTGTAGAAAAAGTTGAGGGATCAACTTAA
TCCTTTTTTAGTATTGACTTCTCTAAATTGAAAGAAATGACGCAAGATTAATTCCTTAAT
CATTTTAAAAATACAAATAAAGTATAGTTAAAAAAGACTGAAGTTTTAGATTTTGGGACA
GCTTGTGTTAAAGCAGGTTTAAGAACTACGAAGGCAGATGCAAGAAGAGCTATGCAACAA
AATGGATTCTAAGTGAATGTCTAAAACTTGACAACCGAAAGATAAATTCAATAAGAAGAT
CTAATTCACAATAAATACTTAATACTTAAAGTAGGAAAGAAAAATTTTGCTCTTTTAGAG
TTTATAGAATGA


>Contig22340.0.g91(protein)
MKKLVSGIYSQPFKHLHNRKLLYFVSNNNLKESNQEQLQNYFPVQDSSVYIGFDPTAESI
HLGNYIGLLALTHFRLAGYNPIVVFGGATALIGDPSGRTTDRQQMLKGQVENNLHKFQTQ
FSYLTKNIDNYISRNSNKIEDLKQTSDIKPYTFVNNYTFYEDLNLINFLRDIGVHFRVNS
MISKDSVKQRIGDSNKQGEGMSFTEFTYQIFQGYDFLRLRQDYNCKLQIGGSDQWGNIAS
GCDLIRRVMNEEAYGATIPLLVNSQGEKFGKSAGNTGAIWCDPTKTEPYQLYQFLLNVTD
QEVEDLLLKLTFIPIEEIQQTMTQHNSKPESRIAQKLLAKTLTEIIHGQESVEKVEGSTQ
SFFSIDFSKLKEMTQDQFLNHFKNTNKVQLKKTEVLDFGTACVKAGLRTTKADARRAMQQ
NGFQVNVQNLTTERQIQQEDLIHNKYLILKVGKKNFALLEFIE