Identifiers and Description

Gene Model Identifier

Contig18254.0.g13

Standard Name

XRN1c

Aliases

Contig18254_0_g13

Description

XRN 5'-3' exonuclease N-terminus

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam03159 ) XRN 5'-3' exonuclease N-terminus

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR048C3.0004885828297914e-109RAT1 SGDID:S000005574, Chr XV
from 421650-418630, Genom...
T. thermophilaTTHERM_006457801.9991716194688635e-85XRN 5'-3' exonuclease N-termin
us family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18254.0.g13(coding)
ATGGGAATTCCAAAATTCTTTAGATGGTTGACTAGAAGGTACCCCCTTATCCTCTAAAAT
GTTCAAAAAGAGGAGGATTGTCCACCTATAGACAACCTATACTTGGACTTGAATGGTATA
GTGCATAATTGCATCCATGGAAATGATCCAAGTAAACATGAAAAAGTAAGCAAGATGGAA
GATTTTGATGAAGTGTGGGTCAGTATAATGAGAGCTATTGATGAGATAGTACACTCAGTC
AAGCCAAAGAAACTTTTGTTTTTGGCAGTTGATGGAGTAGCCCCTAGAGCAAAAATGAAC
CAACAAAGAGCAAGAAGATTCAGAAGTGCTAAAGAGGCTTTTGAATCAAGAGAGCAATTG
AGATAAGAAGGCAAAGAAGCTCCTGAACTCTTTGACACTAATGCCATCTCACCAGGCACT
TAGTTTATGTTTGAGCTATGCAAGCAGCTCCACTTCTTTGTTTAGTACAAAACAAATGTC
GATCCACTTTATTAAAATCTAGCCTAAGTCATTGTATCTGATGGTAGCATACCAGGCGAA
GGTGAGCATAAAATGATGGATTTTATCAGATAAGCAAAGCAAAGTCCATAATATGACCCG
AACACTAGACACTGCTTCTATGGAGCAGACGCAGACTTGATTATGCTCTCGCTTTTGACT
CATGAGCCCCACTTCATTATCATAAGAGAAGAACATATTTTCAAGAAGAGTAAGCAAGGT
GGCGTCTAGAGAATAGATAAAAAGAAATAGGTAAATTTCTAGATAGTTTATATAAACTTG
CTGAGAGAGTACTTTGAGTTGGAATACAAGCCATTGTAATCTTAAATGAAAATACAGTTT
GATCTTGAAAGAATTATTGATGATTTTGTTTTCTTCTGCTTTTTCATCGGAAATGACTTT
TTGCCATCTTTAAGTGCCTTGGATATTAGTGAGGGTTCTTTAGACTAGTTGATTAAGTTG
TATAGAAAACTTTTGCCATAAATGGATAATTACATCACAGAATCAGGAACCATATATTGG
GATAGAGCATAGCCATTTATAAAGATGCTTGGAGAGCACGAGCATGAAAGTTTCATTGAG
AGAGTAAACTAAATGAGATAAAGAGGAGGGGGTAGAGGAGGTGAACAAAGTATTGTCTCA
TCAAGTGTTAGAGAAGTACAAACTACTCAGACATTTATTGGCAAAGACGGCAAAATCGAT
CGCAAAAGAGAAATACAAAGACTGATACAAGTAAAAATTCAAGATAAGAAAAGAATGAAG
ATAGTTAGTATGATTGAAAAGAAGAAAGACAAGTCTTACAAAAAGTACATCACGATTAAA
AAATATTAAGAGGATAAGGATTAAGATGAGATTGAGAAACTTAAAGTACTTGAAAAATAT
CAAAGAAAGCTATGGGAGCAGAATAATGGTTCAGAAGAAGATAAAGAAGAATTTTAGTTT
GATAGAGACCAAGACATTATTTAGCTGTTAAACTTAATTAAGGATGATAGTTTTTCAGAA
CTAGATCCCAATGATATTTTGACAGATGACATAAGCGATGTTGACGAATCCTAAATTAAT
TTATAACAACTTGATGAGAAAATCTAAAAGTAAAACGCTTAAATAAATAAAGCTCCATAA
TAAGACTTGATTGAAAAGTATATGGAAATGAATATGGAATTCATGAAAAAGTTTATTAAA
CTTTACAAAATAGATCCTTTCAGTGCTAAAGCTATAGGAGCTTAACATTGGAGATGGTAT
TATCCTTATCACTATGCTCCTATGATATCTGATATAGATGAAGATATAGTTGAGAACTAT
TTGAAAGGAAGTAAAGTTATTGGAGATTTTGAAATCGATGAAAACTGTTCTCATATCAAC
GAGCCATATAGACCATTCTTTCAACTTCTATGTATCTTACCAGCTAAAAGTGTGAAGTTA
TTACCATAACAGTACTCAGAAATCATTCTAGGAGTGTTGAGAAAATACTTCCCAGACGAC
TTTACTATTGATTTGAATGGAAGATCACTTCCTTGGGAGGCTGTTTGTTTAATCCCGTTT
GTCGAAGAAAGTCTCTTCATTGAGTTAGAGTAATAATTGTTATTAAGATTACCATTAAGC
GACTATGAAAATGTAAGAAATTCAACCAAGTTTGAATATGTAGGCTATTTATATGAATTA
CAAGAGGAATAGGCTATTCTAGAAAGCTCATTGTAAAAGTTTGAGTCAATTAAAAACAAT
CTCAAAACAACAATCTTCTAAGAATATAAAAATGTAGGAAAACATTCCTTCACTCCTTAG
CTTCATCCTAACATCGTGTTACCTTGCCCAAGTTTCCCAAGTTTTAAATGGCTAAATGTT
CAAAGATTGGAATTTGAGAGTGTTCATATTTAGTAAGTAGCTTTCAAAAGAGCTTTGGTT
GTCATCCCATCAAGTGAATATGAATAATCTACTGATGATTTGAAGTATTTCGCAGAATAA
TTTAAAGATAAAGACAACATTAAAATCTATGTGGGATTTCCATATTAACATGAAGCAATT
CCTTAAAGTTTTGAAGATGACTATTCAATATTTACCCTTTTCGAAGACATTCATAACCCA
AACTAAAGTCTGAAAATTATATCGTAGTAATAGAATTTAGAGGGATAAAGACTGGAAAGA
TTTGTGAATAGACAAGTTGAGAAGTTGAGATATGAAGGTATTTTTGTAGAAAACCCCTAT
GCCTTTGTAACTCTTTAGAGGGTAAGTGGTACAGCTTATGACAAAAAGTCTAAGAAATTC
TATAAAACCTATTCTGATAATACTGAAACTATACCTTTGAGCATGATAATGGCAAAAAGA
ACCTAGGATCACTACTTAAGTCTAGAGACCAGATGCAAATCTATAATTGAAAGCATAAAT
CCTGGATAAGAGGTAATATGCTTAAACTAACATATGCTTGGAATCATGGGCAGAGTTGTA
CATTTGGATTTTAAAAGAAATGCAGTCAAAGTAGAATTTGATAAAGAAAGTGAGCAATCA
AAGTTACATGATCCATTTATTGGGTAGGTATGCTTGAAAGATGAGAATTTTGTTAAGAAA
GACCAAATCAAGAGATTCTATAATGAAAAGCAAATCGAAGAAAAACTTAAATTGAAGCCT
GGCGTCATTAATAGAATCACAAGTTCCTTCTTGTTAAGTTATCATGATCCAAATAAGGAA
GACAGATAGGTAATCGATATTGGTTTAAACATAAAGAACTATACCAAGAAAGTTCACATT
CCTTCTTATGTCAGATATGTGATATTGGAGAATGATAAATACAGAGAAAATGATCAAAAG
TATCAGTTGATGGATAGCAATATCTACTCCAATCAACCAGAAAAGAAACATAGAAGGTAT
TGGGAGTTCTCACAAGAATGCGTTAATATACTTTAAGATTATAAAAACAAGTATCCTGAA
ATATTTGAGCTAATTTATGAATCCATTTCTCAAGATAAACAAGTTTTACCAATTAAAGAA
TGCTTCCCTTAAATGAAGCTTAAAGAAGCAACTGAGTATGTCAGTGGAATTGCTAAGTGG
ATTGTATCCCTTCCAACCTCAAAGCTTCCTTATGTAGAAATAGGATATGATGCTCTTCAC
TAGAATCTCATTTAGAGAATCCAAAGCTATCAGGAAGTTTTAAAGTAAGATGGAAAATAA
ATAAAAATAAAGTGTAAGAAATTTGAGTATTTACCTGTATCAATGCTCTTGTTTGAGAAT
TTCCCAATTTACACCAATCATTTCTCGCCTAAGGAAGTTAACGATTTTAACATCGGCGAT
AGAGTGATGAACATTAATTCCACACTAAGAGAGTATGTTCCTTTTGGACATAGAGGTACC
GTAGTTGGTAAAACTTCAGACAAGCTAATCGTTTTGTTCGATCAGCAATATCTTGGAGGA
GATAATATTAACGGTTAGAGTCAGGATTTCAGAGGTGGAAAAGTAGGACCCAACGATTTA
CTAAATCTCACTTAAAAGTTCATGTCAATCTTGAAAAAGAACAAGGACATTGTCTCACAG
TTTTAAGAGATTCCAATGACTGAAAGTGAGTTCAATCAAATTTTGAAAGACTAAAAATTC
AAAAAGCAAAAGTCTAATTAGCATGATTAAAAAGGCTACTCACAGAAGCACCATAACTAA
AGAGAAACAAGAACTTACTCAGCAGACGATACCTTTCAAGAGGAGTCAAAGGAAAAATTC
CAAAACCAAATATCATCTCACAGAAAAGTAATCCACATAGAATACGAAGAGAGCAAAGTC
TAAATTGAGAAGGTAAAGAGCAAGGATGACACTAAACTTTATGTAAAAAAAGAAAAATCA
GTAAAGTAAACTGAAAGTTACTAAGATGATGATATATTCAAGGTCATAAGTACAAGTTCA
AAAACTAAAAGTAAGGAAACTGTAGTTGAGAAGAAATGGGTAGTCAAACAAAAGAAAGAA
CAAGAAGATATTTGA


>Contig18254.0.g13(protein)
MGIPKFFRWLTRRYPLILQNVQKEEDCPPIDNLYLDLNGIVHNCIHGNDPSKHEKVSKME
DFDEVWVSIMRAIDEIVHSVKPKKLLFLAVDGVAPRAKMNQQRARRFRSAKEAFESREQL
RQEGKEAPELFDTNAISPGTQFMFELCKQLHFFVQYKTNVDPLYQNLAQVIVSDGSIPGE
GEHKMMDFIRQAKQSPQYDPNTRHCFYGADADLIMLSLLTHEPHFIIIREEHIFKKSKQG
GVQRIDKKKQVNFQIVYINLLREYFELEYKPLQSQMKIQFDLERIIDDFVFFCFFIGNDF
LPSLSALDISEGSLDQLIKLYRKLLPQMDNYITESGTIYWDRAQPFIKMLGEHEHESFIE
RVNQMRQRGGGRGGEQSIVSSSVREVQTTQTFIGKDGKIDRKREIQRLIQVKIQDKKRMK
IVSMIEKKKDKSYKKYITIKKYQEDKDQDEIEKLKVLEKYQRKLWEQNNGSEEDKEEFQF
DRDQDIIQLLNLIKDDSFSELDPNDILTDDISDVDESQINLQQLDEKIQKQNAQINKAPQ
QDLIEKYMEMNMEFMKKFIKLYKIDPFSAKAIGAQHWRWYYPYHYAPMISDIDEDIVENY
LKGSKVIGDFEIDENCSHINEPYRPFFQLLCILPAKSVKLLPQQYSEIILGVLRKYFPDD
FTIDLNGRSLPWEAVCLIPFVEESLFIELEQQLLLRLPLSDYENVRNSTKFEYVGYLYEL
QEEQAILESSLQKFESIKNNLKTTIFQEYKNVGKHSFTPQLHPNIVLPCPSFPSFKWLNV
QRLEFESVHIQQVAFKRALVVIPSSEYEQSTDDLKYFAEQFKDKDNIKIYVGFPYQHEAI
PQSFEDDYSIFTLFEDIHNPNQSLKIISQQQNLEGQRLERFVNRQVEKLRYEGIFVENPY
AFVTLQRVSGTAYDKKSKKFYKTYSDNTETIPLSMIMAKRTQDHYLSLETRCKSIIESIN
PGQEVICLNQHMLGIMGRVVHLDFKRNAVKVEFDKESEQSKLHDPFIGQVCLKDENFVKK
DQIKRFYNEKQIEEKLKLKPGVINRITSSFLLSYHDPNKEDRQVIDIGLNIKNYTKKVHI
PSYVRYVILENDKYRENDQKYQLMDSNIYSNQPEKKHRRYWEFSQECVNILQDYKNKYPE
IFELIYESISQDKQVLPIKECFPQMKLKEATEYVSGIAKWIVSLPTSKLPYVEIGYDALH
QNLIQRIQSYQEVLKQDGKQIKIKCKKFEYLPVSMLLFENFPIYTNHFSPKEVNDFNIGD
RVMNINSTLREYVPFGHRGTVVGKTSDKLIVLFDQQYLGGDNINGQSQDFRGGKVGPNDL
LNLTQKFMSILKKNKDIVSQFQEIPMTESEFNQILKDQKFKKQKSNQHDQKGYSQKHHNQ
RETRTYSADDTFQEESKEKFQNQISSHRKVIHIEYEESKVQIEKVKSKDDTKLYVKKEKS
VKQTESYQDDDIFKVISTSSKTKSKETVVEKKWVVKQKKEQEDI