Identifiers and Description

Gene Model Identifier

Contig944.1.g4

Standard Name

XRN1b

Aliases

Contig944_1_g4

Description

XRN 5'-3' exonuclease N-terminus

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR048C2.999720831252636e-153RAT1 SGDID:S000005574, Chr XV
from 421650-418630, Genom...
T. thermophilaTTHERM_001452707.002333582705508e-91XRN 5'-3' exonuclease N-termin
us family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig944.1.g4(coding)
ATGGGAGTACCAGCATTTTTCAGATGGTTATCTGTCAGATACCCAAAAGTAGCAATCAAT
GCACTTTCTGATGAAGATTTAGAACATTTATATGATGACTTCAAAAAGACCAGTGATGAT
AACAAAGATCCAAATGAGATTAATCTGTTAGATGGGGATTTGGATGGGGAAATAGAGAAG
CGAGTCCGAGAAAATAATCCTGAATTCGATAATCTCTATCTCGACATGAATGGTATTATT
CATCCCTGTACTCACCCCTAAGACAAGCCACAGCCAACTTCTGAGACAGAAATGTTCAAC
AATATCTTCGATTACACGGATAAAATCATGAAAATAGTGAGACCACAGAGATTGATTTAT
ATGGCCGTTGATGGTGTGGCACCTAGAGCGAAAATGAATCAACAGAGATCTCGTAGGTTT
AGGGGTGCATTAGATACCGAAGAAAGAGAGCAACGTGAGGAGGAAATCAGAGGCAAATGG
TCAAAGGAAGGTATTAAGTTCTCGCAGAAGAAAGATGAAGAGGATGGTGATTCAGATAAA
TTTGATCAGAATGTCATTACTCCAGGCACTGAGTTTATGTTTAGACTCAGCAAAGCTCTG
CAATACTATGTCATGGAGAGATTGCAAACTGATAGTCTGTGGAAAGATATCAAGGTCATA
TTCTCTGATGCCAGTAACCCAGGAGAGGGAGAGCATAAGATTTTGGATTTCATTAGATCA
TAGAGACTATAGGCTGGTTATAATCCAAACACTAGGCATTGCATTTATGGAGCTGATGCA
GACTTGATTATGTTGGGTTTGAGCACTCACGAACCTCACTTCGCAATTTTACGTGAAGCA
GTATTAATGGATTCCGATAAAAAATGCACATATTGCGGATAGAATGGTCACTTAAATTCT
GAATGCAAATCCAACCCAGATATCGCTGGTGGACCTAAAGTTTAACTTTCTAGGAGTAAC
GATTTCTTGCCTCACTTGCCAAGTTTACACATCAGAGAAGGTGCCTTAGATGCTATTTTA
GTAATTTACAAGAACTTATTACCATCACTAGGAGATTATTTGACTAAAAATGGAGAGATT
GACTTCGGAAAGGTAGACATAATCTTTAACGATATTGCTAAGATTGAGGAGGAGTCTTTC
AAGATGAAGAAAGAAAATGAGGAAAGATATGCAGAAAGGCTTCTGAGAGATGCTTAAGGA
GGGAATACAAGAGGTGGCTTCCGTGGAGGCCGTGGAAGAGGAGGCTAACGTGGAGGGTAC
AACAATTAACAAAGACCTGAGCATGTTAAGTTTGACTAATAGCTACCAAAGACTGACACA
GAGGTAGTTTTAGCATCAAAGGTTAGTTTAACAGCTGGAGCTCCAGATGCAATTTTAGAC
AAAGAAGAAATCAAAGTAGAAGCACAGGAATAAGCTAAATTATTAGACTAAGCAAGCGTC
ACTAAACCTGCAGCTGATAGTGTTGAGGAATTTGAGAAGTCATAGATTTAAGAATTAAGT
AAGTTAAAGCAGGAACTTGATGAAGAAGAATTGAATAAACTTGCATCAGATAAAATGAAG
GAAATAGTTAAGAAGATGCTGTCTGAGAAGAACAAATAGATGGCAGACTCATATATAGAT
AAAGTAAAGTTTGGCACTGAAGGTTGGAAGTTAAGATACTATTAAGACAAATTCCACATT
GATGTAAATGATTTCTAGGAATTTACTGATAAAATCAAGCAGGCTTACATTGAGGGTCTT
CAGTGGGTGTATAGTTATTATTACAAAGGGTGTGTGAGTTGGTATTGGTTCTACCCTTAT
CACTATGCTCCATTTGCTAGTGACCTTGTAAACTGCGACAGAGTTAAGATTAAATTCGAA
ATGGGAGTGCCAGCTTAACCTTTTGAGCAATTGATGGGAGTGATGCCTAAGTAATCAGCT
CATTGTATCCCACCATGTTACAGACATCTTCTAAGCAGTCCAAAATCGGAGATTATAGAT
TTCTACCCTATTGATTTCAGATTAGACATTAACGGTGCTCGTTATGCTTGGATGGGAGTC
AATCTTTTACCTTTTATTGATAGGTAAAGACTCATTAAAGCCATGAGAAAAGCAGACTAA
GATGGCGCTAAGCTAACTCCAATTGAGTAGGATCGTAACAGAACAGGAACTGTTATGCTA
TTTTTTGCTAGGAATGAAAAGTCAGAGAGTGCTTTGTAACAAACTTTAGATAAAAAGCTT
AATGGAAACCTAGAACTTTTCGCTTCGTTCTAAAGGAAAGATTAGATTAGTGGAACTGTG
AAAGTCTTAAAGAATGCTCATTAAATTGGTTAGAAAATATCCAGACCACATGTAAAGTTG
TAAATGTCAGATATCACTGACAACTAGGTTTATCAAATAAATTACGAGCATCCTACTTAT
GATTAGCACTTGACTAAGCTTCTTGATGGCTTAAAACATGAGCCAAAAGAAGTAGAAGAA
TTTGAGATTTATAGTTTGAACAGAAGATTCTTTAATGGAGAAAACGCTGTGAGGATGCTT
GAAAGAATCCTTGGTATTGATGCAAGCGTGTCCGCAGTATATAGACCCTAAGGTTATCAA
AATAATCAAGGCAACTATAATCAACAAAGGCAAGTCGATTAAGCTTTCAGAGGTTCTGGC
AGCAGTCAGTATGCTTATAGTGGATAAGGAGGCTATAATTAAGGTTACAGTGGCAGCAGT
GGGCATGGCTATTAATAACAGTAATAAGATCATATGCTTGGCAAGAGAGGGCAAAGAGAC
TATTCTAATGATGATAGGGGCTATCATTAAGATAAAAGGTATGAAGCGAGTGCTCAAGGT
GGCCATTATTCTGGTTAAGGAGGTAACTATGGTCACTAAGGTGGTTACAATAGATAAAAT
TAACACTACTAAGGCAGCTAAGGCTATGGTGGCTATAACTAACATCAAGAACAATAATAG
CAGTAACCACCAAATATAAATTATAATTTGGGTTACAATAACAACAATAGAAGAGATTAC
AATTAGTAATAGAGCCACTCTACTAGTAATCAACACTAAGATTACCAATAATAAAACCGA
TAGAATCAAAGGGGCTATTAATAGAGTAATAGTAGCTATGACAATAGACAGCAATATGGC
AGTAGTAACCAGAACTATCAACAGCATTAATAGTAGTATTAACAACAATACAATCAGTGC
AGCTAATAGTCATCAGTACTAGCTTAACCTCAGCCGTATCAGCAGCCTTAATAGTAATCA
CCTAATTAACTTATCAATTTGCTCTAATAACTGCAGAATGTGCCTTAATAAAGAAATTAA
TAGAATTAGGGATAGAATGGTGGTTAACAATAGAACAACGGATAAGATAGGAATGGCTCT
AATTATAATAGATTCCAAGGATTTGGGTAGTGA


>Contig944.1.g4(protein)
MGVPAFFRWLSVRYPKVAINALSDEDLEHLYDDFKKTSDDNKDPNEINLLDGDLDGEIEK
RVRENNPEFDNLYLDMNGIIHPCTHPQDKPQPTSETEMFNNIFDYTDKIMKIVRPQRLIY
MAVDGVAPRAKMNQQRSRRFRGALDTEEREQREEEIRGKWSKEGIKFSQKKDEEDGDSDK
FDQNVITPGTEFMFRLSKALQYYVMERLQTDSLWKDIKVIFSDASNPGEGEHKILDFIRS
QRLQAGYNPNTRHCIYGADADLIMLGLSTHEPHFAILREAVLMDSDKKCTYCGQNGHLNS
ECKSNPDIAGGPKVQLSRSNDFLPHLPSLHIREGALDAILVIYKNLLPSLGDYLTKNGEI
DFGKVDIIFNDIAKIEEESFKMKKENEERYAERLLRDAQGGNTRGGFRGGRGRGGQRGGY
NNQQRPEHVKFDQQLPKTDTEVVLASKVSLTAGAPDAILDKEEIKVEAQEQAKLLDQASV
TKPAADSVEEFEKSQIQELSKLKQELDEEELNKLASDKMKEIVKKMLSEKNKQMADSYID
KVKFGTEGWKLRYYQDKFHIDVNDFQEFTDKIKQAYIEGLQWVYSYYYKGCVSWYWFYPY
HYAPFASDLVNCDRVKIKFEMGVPAQPFEQLMGVMPKQSAHCIPPCYRHLLSSPKSEIID
FYPIDFRLDINGARYAWMGVNLLPFIDRQRLIKAMRKADQDGAKLTPIEQDRNRTGTVML
FFARNEKSESALQQTLDKKLNGNLELFASFQRKDQISGTVKVLKNAHQIGQKISRPHVKL
QMSDITDNQVYQINYEHPTYDQHLTKLLDGLKHEPKEVEEFEIYSLNRRFFNGENAVRML
ERILGIDASVSAVYRPQGYQNNQGNYNQQRQVDQAFRGSGSSQYAYSGQGGYNQGYSGSS
GHGYQQQQQDHMLGKRGQRDYSNDDRGYHQDKRYEASAQGGHYSGQGGNYGHQGGYNRQN
QHYQGSQGYGGYNQHQEQQQQQPPNINYNLGYNNNNRRDYNQQQSHSTSNQHQDYQQQNR
QNQRGYQQSNSSYDNRQQYGSSNQNYQQHQQQYQQQYNQCSQQSSVLAQPQPYQQPQQQS
PNQLINLLQQLQNVPQQRNQQNQGQNGGQQQNNGQDRNGSNYNRFQGFGQ