Identifiers and Description

Gene Model Identifier

Contig14644.0.g34

Standard Name

XRN1a

Aliases

Contig14644_0_g34

Description

XRN 5'-3' exonuclease N-terminus

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam03159 ) XRN 5'-3' exonuclease N-terminus

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR048C9.998919090800975e-129RAT1 SGDID:S000005574, Chr XV
from 421650-418630, Genom...
T. thermophilaTTHERM_001452705.000624069301489e-83XRN 5'-3' exonuclease N-termin
us family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14644.0.g34(coding)
ATGGGAATACCAAAGTTTTTCAAATGGCTCACTCGCCGTTATCCTTAAGTTCTCCTCGAT
ATCAAGAGGGAAGAATAAGTTCCTCCTATAGATAACCTGTACTTGGATCTAAATGGTATA
GTGCACAACTGTATTCATGGAAATGATGCTAAACTTCATGAGAGAGTCAGTTAGTTAGAA
AACTTCGAGGAAGTGTGGATTAATATTATGAAAGCGATTGACGAATTAGTGCATACCATA
AAGCCTAAAAAACTCTTGTTTTTGGCTGTAGATGGAGTTGCACCAAGAGCCAAGATGAAT
CAGTAAAGAGCAAGAAGATTCAGAACTGCCAAGGATTCATAATTACTTAAAGATAAATTT
CAAAAAGAAGGGAAAGAAGCCCCTACTTTGTTCGATAGCAACGCAATATCTCCAGGAACC
AAATTTATGGAGGAGTTGAGCAAATAATTAGATTTCTTCGTTTAATATAAGCAGAATACC
GATCCAGTTTATTAAAATTTAGAGAAAGTTATTCTATCTGATGCTTTTGTTCCAGGTGAA
GGAGAGCATAAAATGATGGACTTTATAAGACAGGCAAAACATGACGAAAATTATGACCCA
AATACAAGACATTGTTTTTATGGAGCTGATGCTGATTTGATCATGCTTTCACTCTTGACT
CACGAACCAAATTTCATTATTCTGAGGGAAGAGCACGTCGTGAGAAAAATCAAGCAAGGA
GGAGTTCAACGATTGGATCTCAAGCGTACAAACAATTATTAAGTGATGTTTATTAATCTC
CTCAGAGAGTATTTCTTATTAGAATACAGAGCTGTAGCTCCCTAGATGAAAATGAAATTT
GATTTGGAGAGAATCATAGATGACTTCGTATTTTTCTGCTTTTTTATTGGAAACGATTTC
TTGCCTTCATTGAGTGCTTTGGACATCGGTGAGGGTTCACTCGATAGCATTATTGACTTG
TACAAAAGGTTATTACCATCTATGGAAAATTACATTACTGAGGAAGGCAGAATTTATTGG
GATAGAGCTGAGCCTTTCATTAAGATGCTTGGTGAGCATGAGCATGATAGTTTCAAGAAT
CGTGTAAATAAGATTGGAGCCATGCGCAATGAGAGAATAATCAGTTTTGATCCAGAATTT
AACCAAGCTTCTACAACTTCAAATAGAACCCAGCTAATTCAACAAAGAATCCGCGAAAAG
CTTAATGATAAGAAGCGCAAGAAGATCCTTGGAATCAGCTAAAAGAAGAAAGACAAACAG
ACTAAAAAGTTCTTGTTGCTTAAGCGTTTTGAAGAGGATGAGATTAACCAAAGTCTTACC
ATGAAACAAAGACAAATTAGAGATTATGCTCTCATTAAGTATAAGAAACTTTGGGAAAGG
CAAACTTAAGAATTAAACAGTTAGAGTGAAGGACAGCCTTTAAGTGAAGAGAGCAAGAAA
GTTGAATCACTTAAGGAAATAATAAGCAATTTGAAGGAGGAATATTTCTCTGACTTGAAC
ATTGAAGATATTGATGATGACGAAGTGAGTGAGATCAGTGAGAGTGAAATCAACATGGAT
GACATATAGGATGTCAATCTAAACTAAGAACTTGAAAATAAGGTCAAGGTCTCAATGGAC
TTGCAAGATAAATACGAGCAGTAGAACTTTGAGTTTATGCAAGAATTCATAAAGCTTTAT
CAGAATGAGCCAGAAAATGCCAAAGCAATGTACTATAGAGCAAAGGTAAAGTTTGATGTT
ACCACGATTGAAGGAAGATCTCTAAAGAAAAAGATGCTTATGAAATATCTCGAAGGTCTC
TAATGGGTTCTGTACTACTATTACAGAGGTGCTTAACACTGGCGCTGGTATTATCCATAT
CACTACGCACCTATGATTTCAGATCTTGACGAAAATATCGTCAATAACTTCCTTGGCGGT
AAACGCTACATCGATGAATTTGAGATTGATCATAATTGCGCAGACATTAATGAACCATAC
ACCCCATTCCAGCAACTTCTTTCAATTTTGCCAGCTAAGAGTTTACATCTTCTCCCATCT
TAATATGCTAAAATTGTCTTGGGAGAGTTGAGACAATATTTCCCTGACGAATTTGATATA
GATCTCAACGGTAGGACCCTCGCCTATGAAGCCGCATGTCTAATTCCCTTCTGTGATGAA
AAGCTATTTATCGGCCAAGAAACAAGTCTACTTAGAGATAATCCACTTAATGACCATGAT
GATTCAAGAAATATTGTTGCTTTCGACTACAAAGTATACACCTACGATCATCTACTTAGA
CAAAACCAAGTAATTAGGCCACTTCCCCTGGAATCCCCTCTCACCTCATTCAAGGGCCTA
GAGCACAACTATGTCAGAGTAGTGATGTGCGATGAGTACAAATAAGTTGGTAAATTTGCT
TTTGAAGCTAAGTTACTCAAGGGTGTCAAGCAGCCATGTCATGATTTCCCTAGTTTCACA
TACTTAAACATCCAAGAAGTTGATTATGATGAGAAGGTGATGCATGAGGTTTCTTTCAAG
AGAGTATTATTGAAGTTGCCTAGCACCAGAGAAGATGTTGCTACTGAGTACCTCGAAACC
TACGTCAATTCTTTCATTAAGCTTCAGTAAAAGGAAATTTACATCGATTTCCCCTTCTAG
TATGAGGCATTCCCAACATTCTTTGAGAACAAAGAATTCACATACACCATTTATGGAGAT
GATGTCTCTCAAATATACAAAATTCATAAAGACAGACAAGGAATGGACGAGGAGAAATTC
GATATGATGAGAAAGAGATCTATTTATAGACTACAAGATTAAGGGTTCTCAGTTGGAGAG
CCAAATACATTTGTCAGCTTTAATAGATTGATTGAAGTAAGCTTTGACAGTAGATTGAAT
TAATACTACAAAGTGTACTCTTAAGATTCTGAGTTCTTACCTATGTGCATGATTACTAGA
AGACGTGACCCATATCACTTCCATAATGCCAATTTGAGATGCGCCTAATATACTCAAAGT
TTCAAGCCAAATAAGCAAGTTGTATGTTTGAACACTCACTTCTTTGGAGTTATAGGTAAA
GTACAGCAAGTAGATCTTAAGAATAAGAAGATTAAGGTATAATTTGACAAGAGAGAAGAA
CAGTCTAAGATTCATGATCCTTTCATGGGATAAAAATGCTTGTAAAACAAGGACAATGAT
GCTTTTGTACCCCTATAAACTAGACGCTACTTCTCAGATCATCAAATCGAGCAAGAACTG
AAGTTAAAGACTGGTGTAGTAAATCGCATAACTGGCTCTCTCCTTGTAACTTTCAATGAC
CGTCAGAAATACGAACGCTAAGTCATCGATCTCGGATTAAACCTGAAAAATTACACAAAG
AAAGCTCACATTCCAGACTTCGTGAGGTATGTAGTTGATGAGGATGTTGCAGACAATCAG
TTTGACGACTATCATCACAATCATCACGCAAGAGGAGCCAAGCATGTCAGGAAACACTGG
GAGTACGCAGAGGAGTGTCTTGAGATAATCAGAGAGTACAAAGAGAAATATCCTTTCGTA
ATAGATATTGTAGCTAAGACAATGCGGTCAAATAAGCAAATGCTCTCTCTTAAGGACATC
TTTGGCAAGAACCAAGACGAGTTAAGTTCTCAGCAATTTATCAAGGAAATCGCAAATTGG
ATTGAAAAGCTCCCAACATCCAACCTACCCTATGTAGAAATGGGCTTTGACGCTTTGAAC
TCTCAGCTAATTCAAATCATCAATGATCATGGAAAATTGATAAGAGATACCTACAGAAAG
GTTCAATTGAAGTGTCAAGAAGTGGAGATACTCGACCCTACTTACGTCTTTTAAGAGCAG
TTCCCCTACTGGTCTCTGCCTTTCAATGCCAGATCAGTGAATGATTATAGAGTCGGTGAT
AGAGTCATGAGTGTCAGAAGTGTGAAGCGTGAGTACATTCCATTCGGATTAAGAGGCACA
GTAGTCGGTAAAACAAATGACAAAATTATCGTGCTTTTCGATGAGCAATTCCTTAATGGA
AATAGCATCTATGGACACTGCGAAAATTACAGAGGAGGGTTCATTGAGCCAAATCACTTG
ATTAACTTGACAAAGAGATTCAACAGTATTATGAATAGCAACTATAGAGTAGCTCAAAGT
TTCTAAGAGAGACCTATGGATCAAGAAATGATTGATGATTCTTAACTACCAGGAGATGAA
TACAACCCTGAAAATGAGCAAGAGCAAAGATCAACTGATATAGATCCAAGCAAGACATGG
GTAGACGTTTAAGATAAACCTAAGGTCATCCGTAATCAGAAACCAGCAAATATAATGCTT
AACTAGAAACCATCTGAGATTCAACAAAGATAGAACTCAAAGCAAGATGAGGAGCAAAAG
GTGGGTCAGCCAGCAAGCATGGATGATGGAGTTGAATTCAAGCAAACTGTTCCAAGAAAC
TAAAATTACAATAGAAGAGGTGGTAGATAGAACAACAATAGAGAGTGGTACAACAAGGAC
ACTCCACAGAACACCATTCAAAGAGGAGGCAGAGGTGGTCATTACCAGCAAAGAAACTAA
AATTACCAGGGTCAAAGACCTTAAAACTAATACCAGGCGAAACCTCAATAGCAACCACCA
GTAGAACAACAGCAGCATGAGTTAAACGCATTGACTGAATAAATCTAACAATAGCTTAAC
ATTTAACAGCCTGCCTTTATTCCCCAGGATGATACTCAGATGCAAATTGACACCACAACC
TAGTTTGTAGCTGACTAGAACTATCAGTAACAGCAATTAACAGGTTTTGTTCCCTCTCAA
AACCAAATGAGAGACTACTTCTACGATGACGATGATCAAGAAGTATTGGAGTAGGACTAG
AGAGTTGAGGATGAATTGGATCTAAACGATTAGCAAGCCGCCTAGCAATTAAGCTAATTG
CAGAACAACCCAGACTTTTAACAGCTACTTAACATGATGAATATTGCTCAACAAATTCAG
GGAACTCTTAATTTGTTTGCTAACACTGGAAACACTGATGCACCCTCAAACGGTGGATTC
GCTAATGCTCCAAATCCATTTGCAAACTTATTCGGAGGTGCACCAGCACAACCAACACTA
AATCTAAATGCTTAAGAGTTTACTTTCTAATAACCAACAAGCGCTACCTCACATAACGTT
TAGGAAGAGAAGAAATAAGAAGATACCAGCAATAATGATCAGTAATGA


>Contig14644.0.g34(protein)
MGIPKFFKWLTRRYPQVLLDIKREEQVPPIDNLYLDLNGIVHNCIHGNDAKLHERVSQLE
NFEEVWINIMKAIDELVHTIKPKKLLFLAVDGVAPRAKMNQQRARRFRTAKDSQLLKDKF
QKEGKEAPTLFDSNAISPGTKFMEELSKQLDFFVQYKQNTDPVYQNLEKVILSDAFVPGE
GEHKMMDFIRQAKHDENYDPNTRHCFYGADADLIMLSLLTHEPNFIILREEHVVRKIKQG
GVQRLDLKRTNNYQVMFINLLREYFLLEYRAVAPQMKMKFDLERIIDDFVFFCFFIGNDF
LPSLSALDIGEGSLDSIIDLYKRLLPSMENYITEEGRIYWDRAEPFIKMLGEHEHDSFKN
RVNKIGAMRNERIISFDPEFNQASTTSNRTQLIQQRIREKLNDKKRKKILGISQKKKDKQ
TKKFLLLKRFEEDEINQSLTMKQRQIRDYALIKYKKLWERQTQELNSQSEGQPLSEESKK
VESLKEIISNLKEEYFSDLNIEDIDDDEVSEISESEINMDDIQDVNLNQELENKVKVSMD
LQDKYEQQNFEFMQEFIKLYQNEPENAKAMYYRAKVKFDVTTIEGRSLKKKMLMKYLEGL
QWVLYYYYRGAQHWRWYYPYHYAPMISDLDENIVNNFLGGKRYIDEFEIDHNCADINEPY
TPFQQLLSILPAKSLHLLPSQYAKIVLGELRQYFPDEFDIDLNGRTLAYEAACLIPFCDE
KLFIGQETSLLRDNPLNDHDDSRNIVAFDYKVYTYDHLLRQNQVIRPLPLESPLTSFKGL
EHNYVRVVMCDEYKQVGKFAFEAKLLKGVKQPCHDFPSFTYLNIQEVDYDEKVMHEVSFK
RVLLKLPSTREDVATEYLETYVNSFIKLQQKEIYIDFPFQYEAFPTFFENKEFTYTIYGD
DVSQIYKIHKDRQGMDEEKFDMMRKRSIYRLQDQGFSVGEPNTFVSFNRLIEVSFDSRLN
QYYKVYSQDSEFLPMCMITRRRDPYHFHNANLRCAQYTQSFKPNKQVVCLNTHFFGVIGK
VQQVDLKNKKIKVQFDKREEQSKIHDPFMGQKCLQNKDNDAFVPLQTRRYFSDHQIEQEL
KLKTGVVNRITGSLLVTFNDRQKYERQVIDLGLNLKNYTKKAHIPDFVRYVVDEDVADNQ
FDDYHHNHHARGAKHVRKHWEYAEECLEIIREYKEKYPFVIDIVAKTMRSNKQMLSLKDI
FGKNQDELSSQQFIKEIANWIEKLPTSNLPYVEMGFDALNSQLIQIINDHGKLIRDTYRK
VQLKCQEVEILDPTYVFQEQFPYWSLPFNARSVNDYRVGDRVMSVRSVKREYIPFGLRGT
VVGKTNDKIIVLFDEQFLNGNSIYGHCENYRGGFIEPNHLINLTKRFNSIMNSNYRVAQS
FQERPMDQEMIDDSQLPGDEYNPENEQEQRSTDIDPSKTWVDVQDKPKVIRNQKPANIML
NQKPSEIQQRQNSKQDEEQKVGQPASMDDGVEFKQTVPRNQNYNRRGGRQNNNREWYNKD
TPQNTIQRGGRGGHYQQRNQNYQGQRPQNQYQAKPQQQPPVEQQQHELNALTEQIQQQLN
IQQPAFIPQDDTQMQIDTTTQFVADQNYQQQQLTGFVPSQNQMRDYFYDDDDQEVLEQDQ
RVEDELDLNDQQAAQQLSQLQNNPDFQQLLNMMNIAQQIQGTLNLFANTGNTDAPSNGGF
ANAPNPFANLFGGAPAQPTLNLNAQEFTFQQPTSATSHNVQEEKKQEDTSNNDQQ