Identifiers and Description

Gene Model Identifier

Contig3977.0.g97

Standard Name

XPOT

Aliases

Contig3977_0_g97

Description

Exportin 1-like protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYKL205W0.00020003864201578029LOS1 SGDID:S000001688, Chr XI
from 50051-53353, Genome ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3977.0.g97(coding)
ATGTCCCTGACTTGCCAATGTGATGTGGAGAGAAATGGTTTTTAAGATAAAGAAATCAAA
GCCAAAGATAAAAATAAAGTGCTTTAAGTGTACAGATTACAAGGTGAGAAGGATGGCTAG
TAAATTAATGAGATCAAAGTCATGATTAAATATTAGAAAACTATGGATTTAGCAATTGAA
TTTGGTATGAAGGAAATTAAAGGCATCTATCAGTAGAATTTATAGAAAGGCATGCTACAG
TTTCAATTGCTTATTGAGAATAAGCCTGCTAAACCAGCTGCCACTAATCTAGGCAGAAAT
ATTGCAATAAGTAATAGCTTTGGACTGCCATAGCAAGTGAAAGTTTTCTTGAATAACATG
GAAGTATCACTTGCTGAAGGATTAGTTAAAATATTAAAGGAAGAATTTGAAAGAATTCAA
AACTAACTTAAAGGTATAAACTAAAATAGTACTTCAAATAACGAAGAGACTAAAAAGGAA
GTTCAAGGAAATTAAGCTATGTTGGAGTCAAAGAAGCGAAAATTAGATTAGATTTCTAAT
CCTTAGTAAATTAATAACAACCCAAGAAATAAGGTTATGAAAATTTCAGAAAATGTCGCT
AAGCAAAACAAGTAAAATTGTGCCATAATATAAAAACCTAAACCAACTATAGTATTGAGA
GACCTACCTTGGGACATGCTAAGAATTATTTTAAATTTCACTCAAGAGTTAGATTTGAAA
ATCTTAAGGTTTGTTGATAAGTAATTTTTCAGACTGATCCTCTCTCGAAAAACCAAGTTA
GTGTTCAAGAGAAGAGATATACCAGAGAAAATATTCTACAATTTAATGACTAAATCTCCG
AGAATTAAATCACTCACATTCGGTTAAAATTTTAGCAATATCAGTCATACTTCCTTAACT
AATAACGCTATTACTACACCTACTATGATAGCATTGTCAAAGTGCAAAAATTTAAAGGAT
CTCACACTTGGAGATGTGACCGAGCCATACTCTCAAAAAATTCTTGGTGCTGGCATCTAC
AATTTGGAAAGGCTAAGTGTTGTCAAAAAACTTTTCGGCAGCAAATAATTCTAGCTTGAA
AAATTGACATTATATCAATGTGACTAGTACATTCTTGATGCTCTATCTTTGAAAGAGGAA
AAGTTAACATTAGTGAAATTGCATATTGCTTAATTTATCCAAAGAAACACAGAGAAATTG
GAAGAGCTAGATAGCTTGAAGAAGTTTAGAAACATAAATTGGCTGAACTTATGTGGGGCA
TACTACCCACTTTAGTTCTAAATTTAACTTCCAGATGAATAGAACAATCAACTTCTATCA
GTTGCTGGTTGCAGAGAACTTGAGCTAATCTTCTTTTCAATGAAAAACACTCTTAGATAC
CTCACTCTTGGTAAATACGCATATGATGAACTTTTGAATTTTATATCTGAAATGTGTAAA
TCTCTGGAGATGCTTGAAATAAATTCAGATATAGTAACTGATTCAGGTTTAGTACCTATT
CTGAGAAAAATGACTGCACTTAAGACTCTTGATATTGCTGCATGTCCACTCATTACTGGA
ATCTGCTTCTTTGAAGTCGAGGAATTTGGAATCACAAACTTGCAAAGGTTGATCTCTTCA
AACCAAGGATATGAGCAGCAAAAGATCAAAGATAAGTTGAAAGAAGTTGCTCCAAACTGC
TTTTAACAGGTCAGAGAGTAGGCTCAAAGTTTCTGCAATGGGTTTATTCAAAGCAACGCT
GCAAATTTAATTGATTTCTTCAGTTTGCTAGCACAAACTGACAATTAAGCAATGAGATTT
TGGCTTCTACAAGCTATCGTAGAGATAGTCAATAATTACTACGGGCAAGTGATAGTGACA
GCAGAATAGCATCAGATGTTGCATTAGGTTTACTTCTCATTATTGAAGGAAAAGCCAGAG
ATAATTTTTGCCCTAAAACACTGTCAAAATAAATACGCACTTATTTTTGTATCACTTCTT
AGAGAAGACTTTCCATAGATGTGGCCTGAAGCATTTTAAGAATTGCTCTCACTTGTCAAA
CTCACTTCAGAAGTTAACCTTCAAAAACTATATATGAGTTTCATTGTGAAATGCATGCTT
GTATTCGAAGAAGAATTAGTGGAAAGGTCAGAGAAAAAATCAAATGTATTGCTTGAGCAA
TAAAATCGGGTGAAGGATGCCATCAGAAATAGCTCGATTACAGACATAATCTTTATGCTC
TCTTAAGTTTTGCAGAACTATACAATTTTCGATGAAGAGTTAGTAAACAACACTCTTGAA
GTGATGGCCCAACTAATCGACTGGAACGCACTTGAACTATTTGGCGAATAAATCAATATA
TTCAAAGCATTTTTGCAGATGAAAAAATTCAGAAATAATGCATTGTCTTGCATACATGCA
ATTGCTTACAAAGGCATGGACTATCCCCTAAAAGTAGAATTGCTTGTAAATTTGGGATTC
CTAGATATCCTAGAATCTTTCAAAATTAAGTACAGAGAAAGACCTAGCGAGGAATCAGAT
GAGCAGGAAGAGCAAGACTAAGAAGAGGAATTCTTTGAAACGGTGGGTGAAGCAGTAGAC
AAATTAGGATAATGGTGTTTAGAAATATACCCTAACGAGGTAGCCTTAGACTTACTTGAT
ACAGATAAGCCAAAGATAGGCAGAAACATTGTGAATTTCATAAACTTTTGGTTATAGTCA
GTCAAGAAATATCATGATTAGCCAACTTCTAATGTACCAGATGTTTTCAATTAGATATTC
TAAAAACTTCTCGAGGTTGTCATAGGAAGAGTGAAGTATCCAGATTGGTGCACCTATGAA
GAAGGCAATGTGCTGTCAGAGCACGAAGAAGACTACCACGTTTACAGAGAAGAAATCGTA
GTGTTATTTATTAACTTGGCTCATGTAAAACCTTTCCATGACCAATTTATCAGAACTCTA
GCCTAGCTCTTTGAAAGTATCGTTCCAGGCAAGACTCCATTCAATCAAGCTGAAGTTCCT
CTATTCTTAGCTTACCATCTTTAACAAGCTATCCCCTAGAACATGAAAGAACAAGTGGGA
AATGTCTTCTCTGATTTAATGCAGTACATAATAAAAATTGACTTCTTCCAATACGACCAT
AAAATTGTTTCACTCATGCTGCTCGAAGATCTAGTTAGATATCTTCCTTACTTCATTAAA
GATTAGGGATTCCAGAATCAAATTGCTACAATCTTTTTCTCTAAAAAAGCAATTATGAGC
AATGAACCCTAATTAGCAAGCCGCAGTTGTTACCTAATATTAAGGTTGGTTGAGAGAGCT
CAAAACGAGCTAGTTGCTTAAGCTCCATAAATCATAGAATCAACTGTTTAGGTTATAACT
AAAGTGGAGACAGGCTAACACCAAGATCACTTAATTTCATACGATGACCTTCAATATTTA
TATAATGTAATCGGAATTTTTGTCTCAAACAAGAAAATTGACTACGAGTATCGCCGCACT
ACAGAGATATCTCAAATGATGAAAGAAAGCTTTGGAAGAGTTCTGGAAGTTGTCCTTAAC
ATCTTGCCTTCCAATATTAATAATCAAGTAATTAGCGACTTGATTCTGTCCTATCTTCAG
AGAAACGTAAATCTCTTAGGCTCTGATGTTAAGCCTTACTTTTTACTGATCGCAAAATCT
TACATCGAAAGCACTGAATTTGAAAGACTAGACTTATTCTTGACTATAGTCAATTATTCA
ATTACCACTCTAAAATCCCATGGCATCGAATTAATCGATAACATATTCCTTGCCCTCTTC
TAAAAGATGTCCTCTGTGAAGATACCAGAGAGCGACCTCTCAGATATAGACAAAAATAAC
AACAAAGTTTTTGCTGGATTCTTTAGAATCATCTTAACTTCAGTTGAAATTGACTCAACT
TTCTTGTTCTCTTAGGTTAACGCCCCATATTTCAATAACTTCTTGAGTTATGCCATCTTG
CACTTGGAGACGAACATTGAAAAAACCACGAAAAAGACTGTTTTAACTATTTTGAAGGAA
CTCTTCATAGATTTCTCAGGTTTGACTCAGCAATAACTCGCTCAATTTGGAAGGAAATCT
TAGCAACACTCATAAGAATAGTAAATGAAAGATAAATCGATAGTTAATACATACCCTGAA
TTATACTAGTAATTTGTTGAGCAGCTACTTTGGATCTCTGTCAAGTATATCTTCCAGTTA
AATCCTTAACAATTAGAAGATTACAACATGATAAAAATCTTGTCCGATATTTAAGCATTA
TTCTATGTGGCAGGTTTCGGAGAGCAATTATCAAAAGCGCTATAAAGCACTATAAATAAC
TAGGAAGTATCTCAAGTCGTAATGCAAATGTGTGATGGACTAGCTCAGAAATAAATGAAT
AATAGATAATTGCACGATGCTTATCAGAAACTGTTGATTCAAATTAGAGGAAATTAGAAG
AGCAACCCAGTTTTTATATAAAATGTTTAGAATGTATAGAACTTTGTTTAGTGA


>Contig3977.0.g97(protein)
MSLTCQCDVERNGFQDKEIKAKDKNKVLQVYRLQGEKDGQQINEIKVMIKYQKTMDLAIE
FGMKEIKGIYQQNLQKGMLQFQLLIENKPAKPAATNLGRNIAISNSFGLPQQVKVFLNNM
EVSLAEGLVKILKEEFERIQNQLKGINQNSTSNNEETKKEVQGNQAMLESKKRKLDQISN
PQQINNNPRNKVMKISENVAKQNKQNCAIIQKPKPTIVLRDLPWDMLRIILNFTQELDLK
ILRFVDKQFFRLILSRKTKLVFKRRDIPEKIFYNLMTKSPRIKSLTFGQNFSNISHTSLT
NNAITTPTMIALSKCKNLKDLTLGDVTEPYSQKILGAGIYNLERLSVVKKLFGSKQFQLE
KLTLYQCDQYILDALSLKEEKLTLVKLHIAQFIQRNTEKLEELDSLKKFRNINWLNLCGA
YYPLQFQIQLPDEQNNQLLSVAGCRELELIFFSMKNTLRYLTLGKYAYDELLNFISEMCK
SLEMLEINSDIVTDSGLVPILRKMTALKTLDIAACPLITGICFFEVEEFGITNLQRLISS
NQGYEQQKIKDKLKEVAPNCFQQVREQAQSFCNGFIQSNAANLIDFFSLLAQTDNQAMRF
WLLQAIVEIVNNYYGQVIVTAEQHQMLHQVYFSLLKEKPEIIFALKHCQNKYALIFVSLL
REDFPQMWPEAFQELLSLVKLTSEVNLQKLYMSFIVKCMLVFEEELVERSEKKSNVLLEQ
QNRVKDAIRNSSITDIIFMLSQVLQNYTIFDEELVNNTLEVMAQLIDWNALELFGEQINI
FKAFLQMKKFRNNALSCIHAIAYKGMDYPLKVELLVNLGFLDILESFKIKYRERPSEESD
EQEEQDQEEEFFETVGEAVDKLGQWCLEIYPNEVALDLLDTDKPKIGRNIVNFINFWLQS
VKKYHDQPTSNVPDVFNQIFQKLLEVVIGRVKYPDWCTYEEGNVLSEHEEDYHVYREEIV
VLFINLAHVKPFHDQFIRTLAQLFESIVPGKTPFNQAEVPLFLAYHLQQAIPQNMKEQVG
NVFSDLMQYIIKIDFFQYDHKIVSLMLLEDLVRYLPYFIKDQGFQNQIATIFFSKKAIMS
NEPQLASRSCYLILRLVERAQNELVAQAPQIIESTVQVITKVETGQHQDHLISYDDLQYL
YNVIGIFVSNKKIDYEYRRTTEISQMMKESFGRVLEVVLNILPSNINNQVISDLILSYLQ
RNVNLLGSDVKPYFLLIAKSYIESTEFERLDLFLTIVNYSITTLKSHGIELIDNIFLALF
QKMSSVKIPESDLSDIDKNNNKVFAGFFRIILTSVEIDSTFLFSQVNAPYFNNFLSYAIL
HLETNIEKTTKKTVLTILKELFIDFSGLTQQQLAQFGRKSQQHSQEQQMKDKSIVNTYPE
LYQQFVEQLLWISVKYIFQLNPQQLEDYNMIKILSDIQALFYVAGFGEQLSKALQSTINN
QEVSQVVMQMCDGLAQKQMNNRQLHDAYQKLLIQIRGNQKSNPVFIQNVQNVQNFVQ