Identifiers and Description

Gene Model Identifier

Contig10697.0.g51

Standard Name

XPO1

Aliases

Contig10697_0_g51

Description

CRM1 C terminal

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000134809.997093137033517e-262ADL128Cp, putative
SGDYGR218W9.997093137033517e-262CRM1 SGDID:S000003450, Chr VII
from 932541-935795, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10697.0.g51(coding)
ATGCAGCAACAAATGAACGACCCCGCTATTCTACTCGATTTTACCATTCCTTTCGATGAT
TCCAAATTGTTCCTACTCGATTAAGTAGTAAATGTCATGTACACTGGAACACCAAACGAT
AGAGTGATGGCTAACAATATACTGAATTAATTCAAGGAGCATCCAGATGCGTGGATTAAC
GTAGACAAGATTCTTGATAATGCTCCTTCACCAAACACCAAGTTCTACGCTCTTTAGATA
CTCGATGAAGCTGTTAATACTCGCTGGAAGATCCTACCTGATGACTAGAAGCAAGGCATC
AGACAGTTTATTATTGGCTTAGTTTTGAAGCTCTCCGAAGATGAGAGCGTCGCCGCATAA
AATCAACATTTACTTACTAAGCTCAATGCCACACTCATCAGTATTGTTAAGTAAGAATGG
ACCACCACTTGGTAAAACTTCATTCCAGACATTTGCTTAAACGCAAAAGAATCTCAATCA
AAGTGTGAGAACGCCCTAAACATACTTAAATTACTATCCGAGGAAGTGTTTGACTTCAGT
AAAAATGCAGTTCTTGGTTAATAAGCCAAGTAACTCAAGCAGAGCATGACCAATGACTTC
GCTACTATCTTTGAGTTGTGTATGTGGGTACTCTAACAAGCTGTATCTAATCCACAATCT
ATTAAACCTACACTTGTCCGCTCTTGCTTAAAAACCTTCCAAGCCTTCTTATCATGGATT
CCTTTTGCCTACATCTTCGAGACCGAATTGATCCCCACAGTGATAAACCACTTCCTTGCC
CCTACTTCCTCCAGAATAGAAGCAATCAGGTTTTTCACTGAGATTGCAAGTTTGAGTCTG
GAAGACGCCGAAGAGAGCGAACGCAGAGGCTGCAAGGAAAAGATTTGCATGTTCTTCTGC
TTGTTCATTCAAAAAATTACTGAAATCACCAAAGGCAGGTCACTCCTAGACGAATACAAC
AATGTGAAGAATACAAAGACGCAGACTGGTTTTGAGAACTTCGCTAAGCAGCTCGCTCTC
TCAATTTCAGCAGTATTGAAAAATAACATAGATTTGATTGAGGAGACCACAAACACTATG
GAACCCAATGAAAACATCCTCTACTTGCAATAATGTGTGTAAAAGGGATTAGAGTTCTTA
GTGTAATTGAGCAGCATCAGAGAGCAGGAACATGAACCAGATCTAGAGCTTTTCAAGATT
TGCCTTGATTTCTGGCATTTCTTCTGCTATAATATCATGATCAAGACCAAGGGAGAGCAA
TACTTCAGTACTGATCCAAATGCTCAGAATAACATCTTCTAAAACTATAACATTGGCGCA
ATCGGTGGAGGTATACCTTAAAACTTAAACTTAGGTAGTTTCCTGAACAAATCCTTCATG
CATTGCCAAATCTATCCCCCCATCTTAGAGCAAATCAGACTAGTAGCCATCATGAAAATG
GTCAAACCAAAGGAAGTACTTGTCGTATCTGATGAAAATGGAGATGCAGTTGAAGAAGTA
TGGGATGATACAGAGACCAACTCACTCTATGAGACCATGAGAGAAATGCTTATTTACTTG
ACTAACATTGACACTCCATCAATGGACAGAGTCATCCAAAGAACACTTGACGAGTTGACT
GGAGATAAATCCAAGTTCTCATTCGATGGCTTGAACAAGCTCTGTTGGGCTCTTGGATCA
ATCTCTGGTTGCATGTCAGTCGAAGATGAAAATAAATTCGTAGTTTCAGTCATCAAAGAA
CTGCTGAATTTATGCGAGAAAACTCATGGAAAGTCAAATAAGGCTTTAGTCGCAGCAGAT
ATTATGTATGTTGTGGGACAGTTCCCCAGATTCCTCTGTTCTCATTGGCCCTTCCTTAAG
ACTGTCATCAGGAAACTCAATGAGTTTATGCATGAAAAGCATCCTGGTGTGCAAGACATG
GCCAGTGAAACATTCCTAAAAATAGCAAAGCAAACTAAGCACATGTTTGTTCAGAGACAA
GACGCAGACAAAGATCCATATGTGAACGAGCTAATCAGATAAATTCCAGAAAACTAAAAA
GATCTAGAGACCCACCATAAATTAATGGTCTACGAGGGTATTGGTCATATGATTTCCACT
GAGTAAATGCCTTTCATGCAAGAACAGCTACTTTTCAACTGCTTGCAATACATTACATTT
GAATGGGAGAACATCTTGAGATTGGCTAACCAATCCTAAGATTAACTCTTGATCCCAGAC
GTTGTGAAAACCATAGATTTTATTATAAAAGTCAACACTAAAGTTGCTGAGGCTGTCGGA
CATATCTATCTCAGCTATCTCAGAAAGATCTTTCCTGACTTGTTGAGAATGTACGGATTG
TACTCTTAATGCATATCTAACTCAGTATAATTCCGCTCTAATGATAGCATGCTTAAGCAA
ATGAAGATTTTAAGAAGAGATATCCTCAGACTCATTCAAACATACGTTGAGAAATCATAA
GAGGTCCAAATCTTCAACTAGGAAATGCTGCCTACTTTACAAGGTTTGATTGAGGACTAT
CATCAGAGTGATCCAAATGCTAGAGACCCTGAGGTACTTATGCTTTTCGCTACCCTCATT
AAAAAACAAGGAGATATGATAAGCGGATTTTTGGAGCAAGTTCTGTTCCATTTATGCGAA
ACTACACTAGATATGATCAAGAATGATTATGCAACTTATCCAGACTAAAGATAAGGTCTC
TTCAAGTTAGTTGAGAACATAGTAAAGTACTGTACAAGTGGCCTCTTTTAAATGCAATCT
GAGAAATTCCAAACTATCATTCTCACAATTATGTTCGCAATGAAGCATGAGAAGCCAGAG
CTCATGGAGATTGGTTTAGAAACCATGTAAGCTTTGAATGGCTTGGTGATGAGAGAGCCA
CAGATTGCTTCAATTTTCTATCAGAATTTTTATGTTCTTATCATCAGAGATACACTTACT
GTTATGACTGATTACAGACACATGAGTGGATTTAAGGTCCAAGGATAGATCTTGCAGCAG
CTCATTCAAGTAGCTGAGAACCCAAACATTATGTTCACCAAGATAAACACAGATCAAAAC
ACCCCTCACAACTTCAATTCAAATAAAGAATTTGCGATTGGACTCATAATCGATTGTATC
AGCACTCTCTTCCCCAACTTGAATAAAGTCTAGATTGAAGCCTTTGTATTAAATCTCTTC
AACTACTGCTATGACTGGCATCAATTCAAGAGCACTCTAAGAGACCTGTTAATATCTATG
AAATCTTTCAGTAGCAGTAATGACGAATTTTACGAAGAAGAGAAAAAGACTGCACTTGAG
GAGGCAACATAGAAAGAATAACAGAGAAGAAGTGCTATTCCAGGTCTCTTGGGCCCTAAT
GCTTAAACACCATAGTGA


>Contig10697.0.g51(protein)
MQQQMNDPAILLDFTIPFDDSKLFLLDQVVNVMYTGTPNDRVMANNILNQFKEHPDAWIN
VDKILDNAPSPNTKFYALQILDEAVNTRWKILPDDQKQGIRQFIIGLVLKLSEDESVAAQ
NQHLLTKLNATLISIVKQEWTTTWQNFIPDICLNAKESQSKCENALNILKLLSEEVFDFS
KNAVLGQQAKQLKQSMTNDFATIFELCMWVLQQAVSNPQSIKPTLVRSCLKTFQAFLSWI
PFAYIFETELIPTVINHFLAPTSSRIEAIRFFTEIASLSLEDAEESERRGCKEKICMFFC
LFIQKITEITKGRSLLDEYNNVKNTKTQTGFENFAKQLALSISAVLKNNIDLIEETTNTM
EPNENILYLQQCVQKGLEFLVQLSSIREQEHEPDLELFKICLDFWHFFCYNIMIKTKGEQ
YFSTDPNAQNNIFQNYNIGAIGGGIPQNLNLGSFLNKSFMHCQIYPPILEQIRLVAIMKM
VKPKEVLVVSDENGDAVEEVWDDTETNSLYETMREMLIYLTNIDTPSMDRVIQRTLDELT
GDKSKFSFDGLNKLCWALGSISGCMSVEDENKFVVSVIKELLNLCEKTHGKSNKALVAAD
IMYVVGQFPRFLCSHWPFLKTVIRKLNEFMHEKHPGVQDMASETFLKIAKQTKHMFVQRQ
DADKDPYVNELIRQIPENQKDLETHHKLMVYEGIGHMISTEQMPFMQEQLLFNCLQYITF
EWENILRLANQSQDQLLIPDVVKTIDFIIKVNTKVAEAVGHIYLSYLRKIFPDLLRMYGL
YSQCISNSVQFRSNDSMLKQMKILRRDILRLIQTYVEKSQEVQIFNQEMLPTLQGLIEDY
HQSDPNARDPEVLMLFATLIKKQGDMISGFLEQVLFHLCETTLDMIKNDYATYPDQRQGL
FKLVENIVKYCTSGLFQMQSEKFQTIILTIMFAMKHEKPELMEIGLETMQALNGLVMREP
QIASIFYQNFYVLIIRDTLTVMTDYRHMSGFKVQGQILQQLIQVAENPNIMFTKINTDQN
TPHNFNSNKEFAIGLIIDCISTLFPNLNKVQIEAFVLNLFNYCYDWHQFKSTLRDLLISM
KSFSSSNDEFYEEEKKTALEEATQKEQQRRSAIPGLLGPNAQTPQ