Identifiers and Description

Gene Model Identifier

Contig20875.0.g74

Standard Name

XAB2

Aliases

Contig20875_0_g74

Description

Tetratricopeptide repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007604008.000025211074901e-158hypothetical protein
SGDYDR416W1.000159011384939e-43SYF1 SGDID:S000002824, Chr IV
from 1298432-1301011, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20875.0.g74(coding)
ATGAAGAGAACCACTCGCAATAGCAATAAACCGACTCAACCAGTTGTTGAGGTATAAAAC
ACCACCACTGTTGCTGCTGTTGAATCTACAGCAATGATTGTTACTGAAACTATAATTACT
ACTACAACTACTGCGACTGTAATTGAAGTATAATAGGTGTAGATTGATACAAGTACTTAA
ATTGTTGAATAAAATGATGAAATCATCCCTCAATAAATGGTTGAAATTCAAGAAAACAAA
AACTAGTTTGACATTTAGAAATTTTTCAAGGCGCCTGATGAATTTTCTACTGAAGATTAT
CTTGGAACTGTGGCAAATCCATATCATTTCAGATCGTGGTGGAACTCAATTCAAGCTCTC
CCTATGGATAATTACATGAAAAGAGCTGAATTCTATCAAAGAGCTCTTATTTACTTACCA
GGCTCCTACAAGCTCTGGTATGGTTTCTTAAGAGAAAGTAGAAAATATTTAAAGAACTAA
GATCTCAATATCATTAGAGATATCTCTCACTATGATATAGTAAATGATCTCTACGAAAGA
GCTCTTGTCTACATGAATAAAATGCCAAAAATATGGCTAGACTATGCCAAATTCATGTCA
AAGCAATTCCGCATAACACAGACTAGAAAGATTTATGATAGAGCTTTGGTTGCTCTGCCA
GTCACCCAGCATTAACTGATATGGGATCAGTTTATTGGGTGGGCTTCCACTTTGGAAGAT
TTCACAGATTTGGCCTGTCATGCTTATAGAAGATACATCGCTTTTAAACCTGAAGATACA
GAGTACTACATTGACTATTTATTGCAAAGTGACCTTCTAGAAGAAGCATTAGACCTTTAT
CTTTCTCTGCTTCAAGACGAGGGCTTTGTTTCAGCTAAAGGAAAAACAAAGAAATACACA
GATGAAGTTGGAAAACTTTGGATATACCTGGCTTAATACTACATTAGAATGGGTTTATTT
GGTAAAGCAAGAGATGTCTTTGAGGAAGCTCTGGCTAATATCACTACTGCAAGAGATTTT
GGAATCATATTTAACGCATACATGAAATTCGAGGAGCAAATGGTTGAAGAGGATGATCTT
GAAGACGATGAAGAAGAAGAGGAAGAAGGTGGAATTTAAGATTAGATTGAAATGCTTGTT
AACTTGGCTTTCAAAGACATCCCAGATAGATAAGATGATAATGAACAGGATGAAGATAAA
GAAATGAATGAAGATGAAGAGAATCAGGCATCTAAGAAGAAATTCAAGTTAACACATGAA
GATAGGATTAATGCCAGGTTTATAAGGCTTGAAAATCTAATCCAACGCAGACCTTACTTG
ATGTCAAATACTGTCTTGCGATAGAACCCACATAATGTTTACGAATGGCTCAATAGAATC
TAGCTCTGTCAAGACGATCCATATCTTGCCATCAAAACTTACACTGAAGCTATCACAACT
GTTGATCCAACTCAAGCTTTCGGAAAGCCAAGTAAAATCTGGATAAGTTTCGCACAATTT
TACGAACATAATGACGAGGACCTAGAGAACGCAAACTTAATCTATCATAAAGCCACTTAA
TTGCAGTTCAAAAGCTTGGATGAATTGGCCAATTTATACTGTTGCTGGGCTGAGATGCAG
CTTAGACATAAAAACTACGACAGTGCCCTAATGGTTATGTAACATGCATGCACAAGTAAC
AGGCCTTAAAAGAGAGGAAAGAATAGGGATAAACAGCAACAGTAACAACCTCATGAGAAG
ACTAATACTCTGTTCAATAACTTCAAGGCATGGTCGTTCTATGTAGACCTTCTTGAAAAT
TTATCAGCAGTAGATAACACCAAAGCTGCCTATGAGCGCATGATGGAGTTGAGAATTGCA
ACACCACAAACAATCTTAAATTATGCCTCCTTCTTATAGAAGAACAACTATTTTGAAGAG
TCATATAGAGTGTATGAAAGAGCACTGGTATAGTTTGAGTGGCCACATGTCTATGAAATC
TGGGGGTGCTACTTGAGCTCCATCATTGAAAGATATTCAGACTCTAAAGTCGAGAGAATC
AGAGATTTATTCGAGCAAGTCCTTAAGAGTGTACCATAGAAGTATGCTAAGTTATTCTAC
TACATGTATGCTGACTTTGAGGAGCACTTTGGCTTGATAAATCACGCCATGAAAATTTAC
GATAGAGCCACCAAAGAGCTAGACAAGGAAGAAAGATTCGAGTGCTATAATCTGTATATA
TCCAAAGCTGCAGAGTTTTATGGAGTTCAAAGAACAAGGCAATTATTTGAGAGATCCTTT
GAAATCTTACAGGATATAGATTTAATAAAAATTGGCTTGAGATTTGCCAAAATGGAAAGG
AGACTTGGTGAAATAAACCGTGCCAGAGCCATTTATCAGCATTTAAGTCAGTTTTGCAAT
CCTAGAATAAGATAGAACGAGGAGCAATTTTGGAATATATGGGAGAAATTTGAGGTATAT
CACGGAAACGAAGATACTTATGCAGACTATATGAGGGCAAAGAGGACTGTTGAACTCAGG
TATTCAGTTTTAACTCCCATAATATCGAATGGCTTTGAGAAATCAGAAGCATAAGAAATA
GAGGCAGAACAACAAAAAGACTTACAAGAAGTGCAATGA


>Contig20875.0.g74(protein)
MKRTTRNSNKPTQPVVEVQNTTTVAAVESTAMIVTETIITTTTTATVIEVQQVQIDTSTQ
IVEQNDEIIPQQMVEIQENKNQFDIQKFFKAPDEFSTEDYLGTVANPYHFRSWWNSIQAL
PMDNYMKRAEFYQRALIYLPGSYKLWYGFLRESRKYLKNQDLNIIRDISHYDIVNDLYER
ALVYMNKMPKIWLDYAKFMSKQFRITQTRKIYDRALVALPVTQHQLIWDQFIGWASTLED
FTDLACHAYRRYIAFKPEDTEYYIDYLLQSDLLEEALDLYLSLLQDEGFVSAKGKTKKYT
DEVGKLWIYLAQYYIRMGLFGKARDVFEEALANITTARDFGIIFNAYMKFEEQMVEEDDL
EDDEEEEEEGGIQDQIEMLVNLAFKDIPDRQDDNEQDEDKEMNEDEENQASKKKFKLTHE
DRINARFIRLENLIQRRPYLMSNTVLRQNPHNVYEWLNRIQLCQDDPYLAIKTYTEAITT
VDPTQAFGKPSKIWISFAQFYEHNDEDLENANLIYHKATQLQFKSLDELANLYCCWAEMQ
LRHKNYDSALMVMQHACTSNRPQKRGKNRDKQQQQQPHEKTNTLFNNFKAWSFYVDLLEN
LSAVDNTKAAYERMMELRIATPQTILNYASFLQKNNYFEESYRVYERALVQFEWPHVYEI
WGCYLSSIIERYSDSKVERIRDLFEQVLKSVPQKYAKLFYYMYADFEEHFGLINHAMKIY
DRATKELDKEERFECYNLYISKAAEFYGVQRTRQLFERSFEILQDIDLIKIGLRFAKMER
RLGEINRARAIYQHLSQFCNPRIRQNEEQFWNIWEKFEVYHGNEDTYADYMRAKRTVELR
YSVLTPIISNGFEKSEAQEIEAEQQKDLQEVQ