Identifiers and Description

Gene Model Identifier

Contig103.0.g16

Standard Name

WRC1

Aliases

Contig103_0_g16

Description

WRC

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam08879 ) WRC
  • ( pfam10795 ) Protein of unknown function (DUF2607)
  • ( pfam11799 ) impB/mucB/samB family C-terminal
  • ( pfam02932 ) Neurotransmitter-gated ion-channel transmembrane region

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig103.0.g16(coding)
ATGTTCCAAGTAAATAATAAAAACAGCATTTTCGAGGATTTGGATTTCCCTCCACAATCT
CAATCCCCTTGCAAAACAATAACTCGACCTCACTAAACTAATAGAAAGAGTTTAAATACA
GATTTGCTGTTCTTCTATCAAAGAAATGAAAATAGACAAAGAGGTTGCAAAAATACCACA
TTAAGATCCACAAGTAACTGTTAGTTACATTATGCCATTTAAAGAAAGAAACAAATGAGA
TAATCGATTTAGCAAGAAGTACTTTAAAATAACTTTAACATTTATTCAAATGAAATTTCC
AAAGTTTAAGAATAAGATGTTTATAAAAATTAAAACAAAAAATAGAGCAGAAGGCATTCC
AGTCAACTATTCTAAAATACAGCTTAGGGATTAAATGAGATCCAAGCTAAAGTTTCTTAT
ATGTAATACTCATAATAGCAGAATGTTGAAAAAAGAGCGTCAGCCGAGTAAAATTGTTAT
AATAAGTCTTAATTTGACTAAAATAAATGCAATGAAAACACAAATTTGATAATTTCAAAT
CATAAAAACTATAAACAAAATGAGATTTAGAATATATCTAATGAAAAGCTACAATTTTCT
ACAAACTTTGACAAATTCAAAAGATTATTTGAATTATCATGGTATTACCGAAAATCATAG
ATCAAGAATGGTAGATTGGATGATCCAAGTTTTAAGGGTACTCAAAAAACTTAATATTAA
AACATTTATCTAGGCCATCTAGATAATGGATAAGTATTTGTTAGAAAAAATGATTTCTGG
AATAAAATTGTCAAAGAACGATTTACACTTAATTGGACTCACTTCGATGTTCATAGCAAG
TAAATATGA


>Contig103.0.g16(protein)
MFQVNNKNSIFEDLDFPPQSQSPCKTITRPHQTNRKSLNTDLLFFYQRNENRQRGCKNTT
LRSTSNCQLHYAIQRKKQMRQSIQQEVLQNNFNIYSNEISKVQEQDVYKNQNKKQSRRHS
SQLFQNTAQGLNEIQAKVSYMQYSQQQNVEKRASAEQNCYNKSQFDQNKCNENTNLIISN
HKNYKQNEIQNISNEKLQFSTNFDKFKRLFELSWYYRKSQIKNGRLDDPSFKGTQKTQYQ
NIYLGHLDNGQVFVRKNDFWNKIVKERFTLNWTHFDVHSKQI