Identifiers and Description

Gene Model Identifier

Contig15147.0.g55

Standard Name

WHI3a

Aliases

Contig15147_0_g55

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam11928 ) Domain of unknown function (DUF3446)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001945501.0002124404074584e-26hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15147.0.g55(coding)
ATGAATAGTACAAAGGGTTTTAGATTTGCAGCTTCTACAAGAGGAATTAGTAAGTTGTTT
GATAAAGTGAATACTTTTTATTTTTTAGCTGTAAGATACTCAGAGAATACAAAGAATGCA
AACCCTCCAAATGGCGGTCAGTAAAATCCAAAATAAAGAAGTAGTAAGAATAGCTTTCAC
TTATTATATCTTCTAGATTAACCAAGTAACATGCAGTAGTAGCAGAGACCCAACTCTAAC
TAGTATTAACAAAATAGAGGATAAAATCCAAATTTGGAATCACCGTTGCAACACTTACCT
TAGCATCATTAAATGAATTTAGGTCAACACCCCCCTCAACAATTCCCAAGATTTGATGCA
GGTGGCATGCCTCCCCAACAATAGTCTTATCATCCCTCTCAATAATAGTCTCATTAGAAG
TCCCAATATGGCATGCCCCCTCATTAAACTAATATACCCAATTTCCAAAACATCCCTTCT
TAATAGTCTAATCCAAACGGGATGATATACAAAGATTCAAGGAGTCATGTCTAAGATTAT
CCTCCACAGCTAAATGCTTATCACGGTCAAGATTCCTAGTCTTAAAAGCCACCTAATATT
CCACCCTCTGTTGTCTAACAGTCACAGCCTCCCACAAATGATATATTGTCACTCTTAAAT
AATATCAGTCATATGACATCTCAAAATTTTCCATAGTCATTAGCAGCTGCTGGCGGAAAT
TAAAATCTTTTAAATTTAATCTCTGGTCTCGCTCAAAACCCCGTAGCCGCTGCTGGTCTC
TCTGGTCAGAGTGGCAGTGCTGCTACCTCTCACAGTCACATTTAAAACCCACTTATGATG
GGCTAATAAATGAATCAACCAAGTCATTCTTAAAACGCTAAACTTCAGGATTCTATCTCC
AGAATTCACAGTATCTTTGGTCCTAATATCATGCCAATTCCTAAAAACGCAACTAATACT
GTCTATGTTGAAGGTATCCCTCTTGATGCTTCCGAAAGAGAAGTCGCTCGTAAAATATTA
TCTCATTTTTATCAATCATTTTCTTTAGATATTTTCAGACCCTATCCTGGGTTTAAGTCT
GTTCGTTTGATTCCTCGTGAGAAGAAACCTGGTGAAAAAGTCATTTTTTGCTTCGCTGAT
TTTGAAAACGCTTTTCAAACAACCCTTGTCATTAACACTCTTCAGGGTTACCGTTTTGAC
AAAGACGACATATTAGGGCTTTAATTTTCGTATGCAATCACCAATAACAAGTATTCAGGC
ACATCTTAAAATGTGTGA


>Contig15147.0.g55(protein)
MNSTKGFRFAASTRGISKLFDKVNTFYFLAVRYSENTKNANPPNGGQQNPKQRSSKNSFH
LLYLLDQPSNMQQQQRPNSNQYQQNRGQNPNLESPLQHLPQHHQMNLGQHPPQQFPRFDA
GGMPPQQQSYHPSQQQSHQKSQYGMPPHQTNIPNFQNIPSQQSNPNGMIYKDSRSHVQDY
PPQLNAYHGQDSQSQKPPNIPPSVVQQSQPPTNDILSLLNNISHMTSQNFPQSLAAAGGN
QNLLNLISGLAQNPVAAAGLSGQSGSAATSHSHIQNPLMMGQQMNQPSHSQNAKLQDSIS
RIHSIFGPNIMPIPKNATNTVYVEGIPLDASEREVARKILSHFYQSFSLDIFRPYPGFKS
VRLIPREKKPGEKVIFCFADFENAFQTTLVINTLQGYRFDKDDILGLQFSYAITNNKYSG
TSQNV