Identifiers and Description

Gene Model Identifier

Contig3163.0.g47

Standard Name

WDR82

Aliases

Contig3163_0_g47

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00400 ) WD domain, G-beta repeat
  • ( pfam02239 ) Cytochrome D1 heme domain
  • ( pfam08553 ) VID27 cytoplasmic protein
  • ( pfam13360 ) PQQ-like domain
  • ( pfam11768 ) Protein of unknown function (DUF3312)
  • ( pfam10131 ) 6-pyruvoyl-tetrahydropterin synthase related domain; membrane protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008129107.00308173940364e-57hypothetical protein
SGDYKL018W3.99801309251602e-27SWD2 SGDID:S000001501, Chr XI
from 404102-405091, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3163.0.g47(coding)
ATGGACACTTCTTAACCAGTGCAAATCACAGACTAACTCATTGAGTCATTCAAGCCAGCC
CTTATTTTCAAGAATTTTCAAAAAGAAGTCAACTCTATTGATATATCTCATGATGGCAAG
TATCTAGTGGCAGGTTGCGAAGATAACTCAGTTTCACTCTATGATCTTGAGCGCGGAGAC
AAAGTGAACACTTACTACAGCAAGAGATATGGAGTAGATCTAGTTAGATTCACACATCAC
AATAAATGCATTTTGTGCGCATCAAAGCGAGACAACAATTACAGGATTATGTATTGGTCT
CTGCATGATAACAACATTTTATGTTCGTTTATTGGTCACACTGATACTATTACTCACCTG
GATGTAAACCCACTTAACAGCACTTTCGTTTCTTGCTCAAAAGATAACTCAACTAGAGTT
TGGGAGTATGAGAAGAAACAGTGTATTATAAGAGTGAATAAATCAAGAGCTGCTTGTTTT
GATAACACTGGAAACGTGCTAGCTTGCTTATTTGTGAAGGATGGAAGTGGAAGTAGTGAG
AGCAGCAATCAAATTTAGCAAATTCATTTGTTCAATGCTGGTAACTATGAAAGTAAACCA
TTCAGCATTTTCAATTTGGAAGAGTTGCCCGAGATAAAATTCCTTAAATTTTCAGCGAAT
GGTATCTACATAATGCTTGGTACCTCTGAAAACTCAATTTGTCTAATTGATGCCTACGAA
GGAAAACTGATGCACAAATTTACTTCAAACATAAATGAGTCTGGCATCCCTCTAGAAGCC
AATTTTACTCCTGACTCTCGCTATGTAATCTCTGGCTCAGACAACAAGAAAATAGTATTT
TGGAATATTGAGACTGGCAAGGAAACTTAGCTGATGGAATATCACCCCAGCACAGTGGCT
TGTGTAAAATTCTCGCATGTCTATTGTATGCTGATAAGCGCTTGTTAGAATTTAGTCGTT
TGGATCCCTGAGAAAGCCTTTTGA


>Contig3163.0.g47(protein)
MDTSQPVQITDQLIESFKPALIFKNFQKEVNSIDISHDGKYLVAGCEDNSVSLYDLERGD
KVNTYYSKRYGVDLVRFTHHNKCILCASKRDNNYRIMYWSLHDNNILCSFIGHTDTITHL
DVNPLNSTFVSCSKDNSTRVWEYEKKQCIIRVNKSRAACFDNTGNVLACLFVKDGSGSSE
SSNQIQQIHLFNAGNYESKPFSIFNLEELPEIKFLKFSANGIYIMLGTSENSICLIDAYE
GKLMHKFTSNINESGIPLEANFTPDSRYVISGSDNKKIVFWNIETGKETQLMEYHPSTVA
CVKFSHVYCMLISACQNLVVWIPEKAF