Identifiers and Description

Gene Model Identifier

Contig1026.0.g89

Standard Name

WDR77

Aliases

Contig1026_0_g89

Description

con80 domain of Katanin

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004976606.002270911168926e-31hypothetical protein
SGDYJL112W0.000000000000020000882446601127MDV1 SGDID:S000003648, Chr X f
rom 205305-207449, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1026.0.g89(coding)
ATGACCATAACTCAAACATTAGTATAGGAAATACTGACATATTGGCTAGATCCCTCTGTG
AGTATTCGTAGTGCATGTATTGATCCTGGATCTTATTATTTAAGTTTGGGAGATGATCAA
CCTTCAGTTTCTTGTTACGATTTCAAGGACATGGTGTGCAAATTATCTGGGCACTTATCA
AATTGTACAGCATTGACAACTGAAAGATCTCAAAATCCAAGAATATTGATATCTGGTGCA
ATTGACACAAACGTCAAACTTTGGGATATTCGAATGAAAACTTGTATAAACACATTCAAG
TCTCACAATGAGCAAATCACATGTGTAGATATATCACCTGATAGCTTAACAGTAGTAAGC
GGTAGTATGGACGGTAATGTGAAACTATGGGATTTAAGAACAAGCAAATTGCTAAAAAAT
ATCAGTGTGTCAAATTAGGGAGGGTACCCACAGTGTTTATCATTTAATCCTATAGACACT
TGCTTAGCTGTTGGGACATCAGATAAAATCATCAAATATTGGGAGTTATAAGATTTCTCA
ATTATCTCACAAACTAATATCGAGAATTATGTAGCTTAGAAGCTTATCTTTGATAAAGAA
GGTATTCATACTTTTGTGGGTTTCTACGATTGTATTAAAGTCTATAACTTAAATGACCCT
AAGCCAAAACTGCTTGACATGTTACCAAAAGGAGGGTACAGGGACATTTTGGACATAAAA
ATAAATACAGAATAAGGATATCTCTTCACAGTTGAGCAACCAGACTCATAACTGAACACT
GTGGTGCTAAGTAACATTGCAGTTTCAGATATCAATTTCAATCCAAACATAAAACCAAAT
ACCCATGTCCCAATGCCTTCATCCATCTCTGTTGACTAAAAGCCTATTCATACATAATTG
AGGAAAGGTCAATCTTTTGAGCCATAGTAGCAATAAAATATCTCAGGCAGTGGATTCAAC
TAAAAACCCTCACTTCTAGCTAAAAATGGGCAGAATATGATGGGCATTAGTCAATCTTCA
GGATTTAATGTAAACCAAGACTTTCTAGATAAATAGTAACGACCGCCTAGTAGCACCAGC
CAAAAACTTAAAACTTTTTATCAACAACCTAAATTCGATCAACCAACAGATTTAAAACTT
GAAGATTTCTTAAACGATCAATAACCAGGTATTAATATAGATTCAGAATTAAAAGTGTTG
CAGGAATCTGTAAAAGATCATAATAAAATGCTTTACATACTAAAGCAAAGAAATGAGATT
CTTGCTAATATGCTTAAGTACTGGTAGAAAGGGGATTTGAATAGTGTAATTTAAAGTTTT
CAAGTCATTAAGGATCCTAATATAGTAGTTGATGCCCTTGCTTGCACTTTAGCGAACGCT
GATGCGAATTCATCCTCAAACGCTATTGACCAATTCAATTTCGTTTAAGCATTATAGATC
CTCCAAAAACTTGAAGATGTTTTCAATACAGATAAATTTGAATTTCACCTCACAATAGCT
CTAAAAACTTTAAAGAATATTTTGCGAGTATTTTCAGAGAGAATCCTCTCTATAATTAAA
CCTCTGCTTTTGATGGGCGAAGATATTTCTAAACTTAATAGTGAGTAGCAAGATCGAAAG
CGAAAATGTGATTAAATAATTGAGAAAATTGAGGTCATTAGTAAAAGTAAGGGACTCAAG
AAATTGGTGTAGCTTAGCAAGAGCAATAGTAATTTGATGGCTAAAAATGTATAAATGGAT
ATTGAAAATTTGATTAGAAATTGTCGAAATATTCCGAGTAATAGCAATAACTTGGGAAAT
AACGAATATAGCTTAAAAAACAATTTCTTCTGA


>Contig1026.0.g89(protein)
MTITQTLVQEILTYWLDPSVSIRSACIDPGSYYLSLGDDQPSVSCYDFKDMVCKLSGHLS
NCTALTTERSQNPRILISGAIDTNVKLWDIRMKTCINTFKSHNEQITCVDISPDSLTVVS
GSMDGNVKLWDLRTSKLLKNISVSNQGGYPQCLSFNPIDTCLAVGTSDKIIKYWELQDFS
IISQTNIENYVAQKLIFDKEGIHTFVGFYDCIKVYNLNDPKPKLLDMLPKGGYRDILDIK
INTEQGYLFTVEQPDSQLNTVVLSNIAVSDINFNPNIKPNTHVPMPSSISVDQKPIHTQL
RKGQSFEPQQQQNISGSGFNQKPSLLAKNGQNMMGISQSSGFNVNQDFLDKQQRPPSSTS
QKLKTFYQQPKFDQPTDLKLEDFLNDQQPGINIDSELKVLQESVKDHNKMLYILKQRNEI
LANMLKYWQKGDLNSVIQSFQVIKDPNIVVDALACTLANADANSSSNAIDQFNFVQALQI
LQKLEDVFNTDKFEFHLTIALKTLKNILRVFSERILSIIKPLLLMGEDISKLNSEQQDRK
RKCDQIIEKIEVISKSKGLKKLVQLSKSNSNLMAKNVQMDIENLIRNCRNIPSNSNNLGN
NEYSLKNNFF