Identifiers and Description

Gene Model Identifier

Contig21435.0.g5

Standard Name

WDR5b

Aliases

Contig21435_0_g5

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004336902.99851380290819e-19hypothetical protein
SGDYPL151C4.0009493637353324e-18PRP46 SGDID:S000006072, Chr XV
I from 267535-266180, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21435.0.g5(coding)
ATGGCGGACTCTGAAATGAAAGATGAATCTCAACAACCCTCACATCCCATTAAAACTCAC
AAATCTCTTAATATGAATGAAGTCACAACTTGTGTGAGATTCTCTCCTATTCCCCACGCT
CACTCTCTCATGGCAACCTCAAACTTATCTGGACAAGTTAAATTATATAAAATAAATGAC
TATGATTCACTCTCTCAAGAGTCAATTGAACTTGTCAAAGAATTTAAGGATCATCTTTTC
CCAATTAACGATATGAATTTCTCTCAATAGTAACCAGGATTTTAAAATCCATATTTAGCT
TCTTGCGGAGATGACACTCTAATCAATATGTATGACTTGGAAAAATTGTCACTAGTGAGG
TGCTTTATTGGGCATTAATCGTATGTAACAAAGGTAAAATTCAATAATGTGACAAATGTC
CTTCTAAGCTGTGGTACTGATAATCACATAATTCTCTGGGATATCCGTTCAAACAAGGCT
ATTTTCAAAATCTTAGGACATCCAGAGCCAATTACTTCAATAGATATGTCTTTTGATAAT
ACTATGATTAGTAGTTCATCTTATGATGGCTTCGTGAGGCTTTGGGACATGTTGAAAGGT
ACTTGTTTAAAAACTATGGTCGCTGAAAGTGGAAGTGATACACCCATTGGATTGTGTAAA
ATGACACCTAATAGCAAGTATCTTCTATTTGCTAATCTAAATAATAAAATGGGACTCTAC
AACTATAAGAATGATTAAATGAAGCAATACATAGGGCATAAAAACGAAGAATACTTAATT
GATGGACTATTCTTCAAGAACAAAGAAACTCAAAAAATGGTGGTGCTTTATGGAGGAGAA
GATGGAAAGCTAAGTGGTTGGGACTTGAATTCTCAAGATCGTATTATTGAAGAGAAAATT
GATTTTGATTAAAGAAATACACTTGTAAGCTCAATTGATTATGACATTAACAACGATTTG
ATTGCTGCATGCGGTAACTACAAAGGCATATATTTTAATAAAGTATCAAATCTAATAAGA
TGA


>Contig21435.0.g5(protein)
MADSEMKDESQQPSHPIKTHKSLNMNEVTTCVRFSPIPHAHSLMATSNLSGQVKLYKIND
YDSLSQESIELVKEFKDHLFPINDMNFSQQQPGFQNPYLASCGDDTLINMYDLEKLSLVR
CFIGHQSYVTKVKFNNVTNVLLSCGTDNHIILWDIRSNKAIFKILGHPEPITSIDMSFDN
TMISSSSYDGFVRLWDMLKGTCLKTMVAESGSDTPIGLCKMTPNSKYLLFANLNNKMGLY
NYKNDQMKQYIGHKNEEYLIDGLFFKNKETQKMVVLYGGEDGKLSGWDLNSQDRIIEEKI
DFDQRNTLVSSIDYDINNDLIAACGNYKGIYFNKVSNLIR