Identifiers and Description

Gene Model Identifier

Contig11605.0.g34

Standard Name

WDR5a

Aliases

Contig11605_0_g34

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007605202.0004907641180118e-81hypothetical protein
SGDYLR222C1.9993007828132465e-27UTP13 SGDID:S000004212, Chr XI
I from 581771-579318, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11605.0.g34(coding)
ATGGTAGGATTAACTTCAAAGTAAAGAGAGGAATTAAATGTGGCAATCCATGAATATTTA
GTAAAGAATCGGTTTACCAATTCAGCTTAAATCTTTGCGGAAGAAACAGGCATATAGGAT
GAAGATTCAATTCAAAATAGTAAAGCATCGACAAGTTTAGGAATCAAAGATGTGCTGGAA
AAGAAATGGACATCTGTAGCAAAGCTTAAAAAGCAAAATATAGAGTTAGAGCGATAAAAT
AAATAATTCAAGGAGCAGATGGTCTGTGAGAGATGCGGAGGGGGTACAAGTTAAATACAA
GGAGGAGCGAGTAATATAGCAGGGGCGGTCGGAGATGGGTTGCCGAGACAGCCTGAAAAA
TACACTTTACTTGGACACAGATAGAGAATAACAAAAGTTCAAATACATCCAATATATCAA
GTTGTCGCTTCTTCAAGTGAAGATGGATCAATAAAACTGTGGGACTACGAATAAGGAGAA
TTGGAAACAACAATGAAGAGTCATACTGGCTGCGTAAATTATATATCGTTTCATCAAAGT
GGTAAATTTCTAGCATCATGCGCTACAGATCAAACTATAAAGTTATGGGATTTGCAGACA
CATTCAGTGTATAAGACTTTATAAGGTCATGAACATGAAGTTTCATGTGTAGAATATCTT
CCTGGTGGTGATTAGATTGTGTCATGCTCTAGAGATAATACAATAAAAATATGGGACACG
TCAAGTGGTTATTGCTTGTAAACTATACCTGCACATTCTGAATGGATCAGAAAAGTAGCA
GTAAACTTGAAGGGATCACTGCTTGCATCAGCTTCAAAAGATGAATCTATTATAGTATGG
AACTTAGAAAAATTAAAAGACGCAAAAAATAATACATCGCAATAATAAGACTCAATAATA
TCAGTACTAAGAGAGCATGAGAATCAAATAGATTGCATTGTCTGGGCGCCCCCAGAATCT
TGTCTAATAATTGATAATGCAGATTATAACAAAAATTTCCTAGCTTCACTCTCGATGTAA
AATAATGATGCTCAGGGAAATGGAGATTATGCAGGATCATTAGCAACTCCAGGTTTTGCA
GATTCATCATAATCGCCATTAGAAGAATCAAAAGATAATGGAGCAAGCGGAGGTGGATAG
GAGAAGATGACCACTAAGGAGAAAATTTAATAAATGAAATTAAAAATGCAGGCACGAAAA
AAAAAGGATGATGGGTCACTACCAGAAGAAGAGAAAAAATAATAACCTTCTAACCATATA
GTTTTAAGCGATGATGTTCAGAGAGATTACTTAGCATCTGCTGCAAGGGATAAAACTATT
AAAATATGGGAGGTACGTAATTGCAGATGTGTAGTTACGCTGTAAGGTCATGATAATTGG
GTAACAGATTTGGTGTTTCACCCTGGTGGGAAATACTTGCTCTCCTCTAGTGACGACAAG
AGTTTAAGAATATGGGACTTGTCGAATGGACGTTGCTATAGAAAAATATAAAACGCACAT
GACCACTTCGTAAGTTCAATCGATATGAAAGCCAAGGTGGTAGTCACGGGCAGTGTAGAT
AAAACTCTCAAGGTATGGACGTGTCGTTGA


>Contig11605.0.g34(protein)
MVGLTSKQREELNVAIHEYLVKNRFTNSAQIFAEETGIQDEDSIQNSKASTSLGIKDVLE
KKWTSVAKLKKQNIELERQNKQFKEQMVCERCGGGTSQIQGGASNIAGAVGDGLPRQPEK
YTLLGHRQRITKVQIHPIYQVVASSSEDGSIKLWDYEQGELETTMKSHTGCVNYISFHQS
GKFLASCATDQTIKLWDLQTHSVYKTLQGHEHEVSCVEYLPGGDQIVSCSRDNTIKIWDT
SSGYCLQTIPAHSEWIRKVAVNLKGSLLASASKDESIIVWNLEKLKDAKNNTSQQQDSII
SVLREHENQIDCIVWAPPESCLIIDNADYNKNFLASLSMQNNDAQGNGDYAGSLATPGFA
DSSQSPLEESKDNGASGGGQEKMTTKEKIQQMKLKMQARKKKDDGSLPEEEKKQQPSNHI
VLSDDVQRDYLASAARDKTIKIWEVRNCRCVVTLQGHDNWVTDLVFHPGGKYLLSSSDDK
SLRIWDLSNGRCYRKIQNAHDHFVSSIDMKAKVVVTGSVDKTLKVWTCR