Identifiers and Description

Gene Model Identifier

Contig9462.0.g84

Standard Name

WDR43

Aliases

Contig9462_0_g84

Description

Dip2/Utp12 Family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDR398W0.00007000107212225429UTP5 SGDID:S000002806, Chr IV
from 1267471-1269402, Gen...
T. thermophilaTTHERM_000777800.0000899730839127287hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9462.0.g84(coding)
ATGTAAGATCCCATTCTCTCTCATTTAAGATTATAGCTCTGGGATATTAAGGGGAAAGCA
AAATGTCTTAAGAGATTAAAGCCATCAAAGTAAAATGATTTAGTTGCAGGCAAGCAAAAT
AATCAGTCATAAAACAAGAATTAGGGATCTACTAGATTCACCACTCTATAGTTTGCAGCT
CAAGTAATATAATAGAGATTAATTAAAAATTTATAGAACGATTACGTTTTAGTAGCAGGT
TTAAGCGATGGCTCTCTCTAACTTATAGACTGCTCATCGGCCTAAGTTTTGAAGGATTTA
GCTAATGTCTCAGGAAATTCCTCAGTGAATGCAGTGTAATTTTACAGAAAGCAAGATAGT
GTATTCAAGATGCTGATTGCCTCAGAAGACAACTATGTAATTTTTGATTATCAAAAGCAA
TCTGTAATTGACAGCATAATCAGCTCATAATAGAAGAAAAAGACAAACCCTACTCCATAA
TTCTTGGACTTAAGTTATGATGACCAATATGCTATTGAGGGGTATTAACATCAAATTAAT
TTGAGAAATCTTAAAAACAAGCATGTGATTGCGAAATTCGAAGGTCATCAATATAACATT
AGAAATTTGGCATTTGCGACCAACACATAAAGCTACCTATTTATCTCAAGTGCTAACAGC
GAGTGTCTACTATGGAACCCTAAAGAATAATTAAAACAACAAAGTGCTGGACAAGTTCTT
GAAGTATCCAAACCTGATAAAATCCTAGATTTAGGAGCCACCGACAATATTACTTTAGTT
TCAGTCAAAGAATTAGAAGACAGTATTTTCATGGCAGCAGTATCAACAGAGAACTATACA
AATCTTTATTACACTAAGTCCAGTGGGTAATAGAGCTCTCAAACATAAATGAATATTCTG
CATGGTTCAGTATTCGCTATAAAGAAGAGTTTAGTATCTTTGACTAATGATCAGGGTAAA
ATTGAGAAAGATATCATGTTAGGCAAATATAACGAGGAAGAGGAGAAAAAGAATCTTAAT
AGGAAATAAGCTGCCAATTAAGATGGGTATGCTGTTACTGGAATCGAAGAGGAAGGTAAC
GCTAAAGTTAATGGGTTATTGAGCGCACAACTTTACTCTACTAAAATGAATCTCTCCCTT
ATTCCAGAATTAGACGGTGACCACTTAGAATCAAGACTGACTTCAGTGAGTTCCAAGAAG
CAATCCATCAAGCCCACATCTGGTTCCCTCTCTGTCATTCTTTCACAAGCCCTGACTGCA
GACGATACTGAGACCTTGGATTGGATTCTAGGCTAGAAAGACCAATAAATGATAACAAGC
ACTATTGTAAATATGAAGGAGCATAAACATATCAGTGCCCTATTTAAGCAAATCGTGATA
AAGTTCCAGTAAGAAGGCGGTTCTTCTAATATAAAGGAAAATGCTACACAAACTTAATAA
AGCGTTGTGATGTGGCTCAAGACTCTTCTGGCTCTTCACTGGTCTTAATTATTGAAGAAG
GCAGATAAGGAAGACTTAAAGAGTCTAGGAGCTATTCAATCATATATTCAGAAGAAGACT
AAGTATATGGACAAGGTTATGCTTCTTAAGGGCAAGCTAGAGATGTTACAAAACACTATT
GAAATCAGAAAATAAATTTCTTAAGGTTTAACTCAGCAAGAGAAATCAGCCAAGAATAAA
CAGCCCATGCTCGTTTACAAAGATGCAGAGGATGATGAGGATGAGTTAATGAAGGATGAG
TAGGAAGAAGAAGATGAAGAAGACAACGACTCTGAGGATGAAGAAGAGGAAGACGAGGAA
ATCAGAGAGATTGACATCAAGAACCGCAAGAGAGCAAGAAAAGACAATGCCGATGAAGAG
GAGGATGATGAAGACTTGGATGACTCCATCGATGAGGAAGAGAGCAAGAAGGATGATGAA
GAAGAGATGATTGTTGAGGAAGATGAGGAGATCGACTCTGATGTGTATGGAGGCGAGGAT
GATGATGAAGATGACGTTGACAACTACGACAAGCTCGTGGAGAGCTCTGATGATAACGGC
GGTGCTGATGTTGAAATGCAGGAGGAGAGCGATGAAGAGGATGAGCCAGTAGTCAAGAAA
TCAGCAGGGAAGAGAAGCACCAGTTCCAAGAAGAGATGA


>Contig9462.0.g84(protein)
MQDPILSHLRLQLWDIKGKAKCLKRLKPSKQNDLVAGKQNNQSQNKNQGSTRFTTLQFAA
QVIQQRLIKNLQNDYVLVAGLSDGSLQLIDCSSAQVLKDLANVSGNSSVNAVQFYRKQDS
VFKMLIASEDNYVIFDYQKQSVIDSIISSQQKKKTNPTPQFLDLSYDDQYAIEGYQHQIN
LRNLKNKHVIAKFEGHQYNIRNLAFATNTQSYLFISSANSECLLWNPKEQLKQQSAGQVL
EVSKPDKILDLGATDNITLVSVKELEDSIFMAAVSTENYTNLYYTKSSGQQSSQTQMNIL
HGSVFAIKKSLVSLTNDQGKIEKDIMLGKYNEEEEKKNLNRKQAANQDGYAVTGIEEEGN
AKVNGLLSAQLYSTKMNLSLIPELDGDHLESRLTSVSSKKQSIKPTSGSLSVILSQALTA
DDTETLDWILGQKDQQMITSTIVNMKEHKHISALFKQIVIKFQQEGGSSNIKENATQTQQ
SVVMWLKTLLALHWSQLLKKADKEDLKSLGAIQSYIQKKTKYMDKVMLLKGKLEMLQNTI
EIRKQISQGLTQQEKSAKNKQPMLVYKDAEDDEDELMKDEQEEEDEEDNDSEDEEEEDEE
IREIDIKNRKRARKDNADEEEDDEDLDDSIDEEESKKDDEEEMIVEEDEEIDSDVYGGED
DDEDDVDNYDKLVESSDDNGGADVEMQEESDEEDEPVVKKSAGKRSTSSKKR