Identifiers and Description

Gene Model Identifier

Contig1886.0.g11

Standard Name

WDR3

Aliases

Contig1886_0_g11

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008564705.00077931415004e-148hypothetical protein
SGDYLR129W4.000944328304913e-112DIP2 SGDID:S000004119, Chr XII
from 399657-402488, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1886.0.g11(coding)
ATGGTTAAAGCTTATTTGAGGTATGTCTAATAAGACATCGTAGGAGGGTTAGTAGGAAAC
TAATCTAATATTTAACTTTGCACTATCACAGACTAAAACGGATAAGTGAGGGGAAATTAT
TTAGTCTCTGCATCAAATGAAGTCGTCAATTTTACTAACACCTAAACTGGCCAAATTGAT
TTCAAGATCTATGACGATTAAGCATTACATGGTCAAGTTAGATAACTAAAAGTCTCTTTA
GATCTTTTAGCAATAGGTTTCAATGATGGAACTATTTAAGTATACAAAATGCAAACGAAT
GAAGATGGAAAATTAGAACAATAGCACAGTTTTACATTCCATAGATCTGCGATTACTTCT
ATCATATTCTTCGCTGACAATACTTAAATGGCAAGTGGAGCTTAAGACACTTATGTAATC
ATATATGACTTAGTAGGAGACACTGCATAATTTAAGTTAATGGGTCACAATGAACATATC
ACTCAACTTTCTACTTTCAACTATAGAAACTCAATTTCAGGCTATGAACATTCAGTACTA
ATTTCTAGCTCCAAAGATGGCATGCTCAAGTTTTGGGATTTGGAATCGTAAAGCTGTATT
TTGAATTCAAGTGATCAATACTTGTCTCCAATTACTGATTTCGTTGTAATTCCTGAGTTG
AGAGCAATAGTTGCAGGATCACAAGATAACTAACTTAGAATTTTCAAAGTACTTTAAAAT
CAAGAAAATGGAGAATTAGAATGCAAACTTTCAAGCATTTTCAAGAAAGACAGTGGTTCA
AAACTTATTGAAATGCATTACAATGCAGCAGACAAGATAATTTCACTTATTAGTTCTGAC
AATAAGTTCGAAATCATTAAAATCAACGTTGACAAGAAAGACTCCTTGATTAAAAAGCTC
CTGAGACAATCAAAAAGAAAGGCACTTAAAAGAAAGTAAAGAGAAGAAGAATAAGAGGAT
GATGAGAATAAAGTCATCGAGATTTAGGTTGACAAAGACGAGATTGTTAACAATTTTGAA
AAGGGAAACTATGATGTGTCAATTCATTTCTCCAAAAAATTAGCTTTCGAACTAGACTCA
TCTACTAAAGTTAAATCCTTATAAATAATGAAGAGATAATCAACTAAGAAGAGCAATAAC
ATTGACATTTTTACATCTTATCACTCAAATCAAATTTATAACTATCAATATGACCTTTTA
TCTGACAAAAAGGAGCAAGTCATGCCAAAAGTGCAAAGGATTTATGGAGAATTGGACGGT
CATAAACTAGCAGTAAGAGGTGTTTCAATCTCAGAAAATGATGGAATAATGGCTACAACG
TCATTTGATTCAGTAAAACTCTGGTAAATTGATTTTAGCTCACAATAGGAGCATCTTAGA
ATGACTTGCTCACAATCAATTGATTAGTAGAACGTTACTGCTATTTTGATTATTCCAGGA
AACAAGTATGTGCTAATGGGAACAAAGGATGGATCTTTACTCCTACATGATATTCAATCA
AATGAACTGATTTATTAGGAAACTAGCAATAATCACTCAAAGGAGATTTGGGAACTTGCA
ATGCACACAAACCCCCAAGTTCCTGATGCTAGAGGAAATCTTATGATTGCCTCATGCTCA
TCAGACAAGACAATTAAATTCTGGACTCTGATTGAAACTACTGATGAAGTTATGGGCGTA
AAGTTCTCTCCAAATGGTAAATATTTCGTGTTCTCTTTGCTTGATCAAACCATGAAGATT
TGCTACCTAGATTCAATGAAGCTTTCTCTTAATTTATATGGACACAAACTTCCAATATTA
AGTTTCGATATCTCTTCAGATAATAACTTGCTAGTATCTTGCTCTGCAGATAAAAACATT
AAGATTTGGGGTATGGACTTTGGAGATATTCATAAGTCAATATTCGCTCATTAAGATTCA
ATTACTTGTGTTAAATTCATCAAAGAAACTCATTATTTCTTCAGTTGCTCAAAAGACAGA
GAAGTAAAGATGTACGATGGAGACACCTTCGATGAAATTTTTGTGTTCGATAATTTCTTT
GGTGAAGTATGGGGCTTAGCTTGCTCAAGTGTTGGAGACTTCTTTGTTGCTGTATCAGCT
GACAAAAATATCAGAATTTGGAGGTAAACTTAGGAGCAAGTTTTTATTGATGAGGAGAAA
GAACGCAGAGAAGAGAAGTTAATGCTTAAAGAAGCTGAGAACGAATTTCAAGAAATTGAT
ATTGCAAGATCCAATCAAGTTGATCCTTTTTCTAAAGATAAGGTCATGAAGATTGAAACA
GCTGCAGCTAGCAAGAAAACTGCTGAAAATCTCAGATACGGAGAAGATTTGATGGAAGCT
TTAGAAATGGCTGAAACTTTTAAAGAAGAAATCGAGCAATATGAAATGGCACTTGATGAA
ATGCAAAAGAATAAAAGCAAAGTTTAACCCGCAAAGCCAAAGCCATCCCCAATGTTCTTG
AATAGAAACATTTTCCAACATGTTCATTATCATTTAAGATAGATTAGACCCTCAGAACTC
GAAAATACTCTCAGATTCCTTAACTTCAAGCAAAGTACTTAATTGCTCTACTACCTAGAG
AACTCAATTAGAAATAATATTGACATTGAGATCAGTGCTAGATGTTCCATGTTCATTTTA
GAAACATATCAGGCTCAAATTCAAATGACGATGGAAATGCTACCAATTGTTAAATCAATC
TCAAACAACCTCAGACTTTAATACAAATATATGAGAGACTTAATTGGTATGAATGTTTCT
GCTTTGAAAATAATAGAAAAGGATGTTTCAAGTTCTATTGCTGGCTAATTACAATTTAGT
GATTTTAACAGTCCATTCACTTTTTGA


>Contig1886.0.g11(protein)
MVKAYLRYVQQDIVGGLVGNQSNIQLCTITDQNGQVRGNYLVSASNEVVNFTNTQTGQID
FKIYDDQALHGQVRQLKVSLDLLAIGFNDGTIQVYKMQTNEDGKLEQQHSFTFHRSAITS
IIFFADNTQMASGAQDTYVIIYDLVGDTAQFKLMGHNEHITQLSTFNYRNSISGYEHSVL
ISSSKDGMLKFWDLESQSCILNSSDQYLSPITDFVVIPELRAIVAGSQDNQLRIFKVLQN
QENGELECKLSSIFKKDSGSKLIEMHYNAADKIISLISSDNKFEIIKINVDKKDSLIKKL
LRQSKRKALKRKQREEEQEDDENKVIEIQVDKDEIVNNFEKGNYDVSIHFSKKLAFELDS
STKVKSLQIMKRQSTKKSNNIDIFTSYHSNQIYNYQYDLLSDKKEQVMPKVQRIYGELDG
HKLAVRGVSISENDGIMATTSFDSVKLWQIDFSSQQEHLRMTCSQSIDQQNVTAILIIPG
NKYVLMGTKDGSLLLHDIQSNELIYQETSNNHSKEIWELAMHTNPQVPDARGNLMIASCS
SDKTIKFWTLIETTDEVMGVKFSPNGKYFVFSLLDQTMKICYLDSMKLSLNLYGHKLPIL
SFDISSDNNLLVSCSADKNIKIWGMDFGDIHKSIFAHQDSITCVKFIKETHYFFSCSKDR
EVKMYDGDTFDEIFVFDNFFGEVWGLACSSVGDFFVAVSADKNIRIWRQTQEQVFIDEEK
ERREEKLMLKEAENEFQEIDIARSNQVDPFSKDKVMKIETAAASKKTAENLRYGEDLMEA
LEMAETFKEEIEQYEMALDEMQKNKSKVQPAKPKPSPMFLNRNIFQHVHYHLRQIRPSEL
ENTLRFLNFKQSTQLLYYLENSIRNNIDIEISARCSMFILETYQAQIQMTMEMLPIVKSI
SNNLRLQYKYMRDLIGMNVSALKIIEKDVSSSIAGQLQFSDFNSPFTF