Identifiers and Description

Gene Model Identifier

Contig4281.0.g49

Standard Name

WDR12

Aliases

Contig4281_0_g49

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000772209.999142814001536e-47hypothetical protein
SGDYOR272W0.00000000000020009182674645818YTM1 SGDID:S000005798, Chr XV
from 832813-834195, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4281.0.g49(coding)
ATGAACAAGACAGCAGGAGTAGTAAGCGCTGACAAGCAAATGACATCAGAAGTGCAAGTC
ACTTTCAAAACTAACCTTCCAGAGGAATATCAAGTTCCCGAAGTATTTATTAGTATTGCT
ACTGGCTCAACTAACAAAGAATTGACTCAGATCTTAAAGTAATTGATGAGTGAAGATAAT
GTGGACATCAAGGGCAAGAAGTTCAATTTCATGATTAACAGTGTTTTCATCACCACAACA
GTTTAAGACCTATTTGACAAATTGGGATTGCAAAATGAAGAGGGTGTTGAAATTTACTAT
CAATTTGCTTTGGATAAGCCCAAGCCAACTCATTCAATCCCATAAGATGAATGGATCTCT
ACTATTCGCTCTTTATCTCATATTATGAATGAGAAAGCAAAGACTTATATTGTAGGTTTT
TTCAACGGAGATGTGAAAGTATTCAGTAAAAACGATCATTAAGAGCTCTTGAACATCAAG
CAACTTCATTAAGACTCAATGATATAAGATGCATTATTCCTTAAAAATGACTTATTAGAC
AAGAAAATCGTAGTGACTTGCAGCAACTTACCTCAATCAGAGCTTAGAATTGGAGAAATC
ACTTAAGTTAATGGAAAGTTCGGTTATAGTCAAATCGCACAAAGCAGAGAGAGTGATTAT
GGAAACATTAACGATGGCTTCAAATGTCTCAGCTCAAACCCAATGAACAACGAATACATT
TGCTCAGCATATACTTCCTCAGAGCAAGCCCCTGAGAAAGCCATTCTTATATGGAGAATG
AACAAGCACACTTTAGAAGGTGACTCATCTTAAAATCAAATTAAATCATAAGGAGGTATG
AAGAGAGTAAAGACAAACATTGCCTATATTGGTTCACACAGCTAAATTGTATGTAATGGT
GGAGTTTAATGCATGAAGTGGGCTACCCCAGAGAAAATTTATGTTGGGAGCAATGATCAC
TCAGTTAAAATTATTAATGTTGAGAAATAAGCAATTGAAGAAGTAATGTTCACAAACTAT
AAGGTGCCAACTTGCATCGATTCAGCTTAAGATAGTCTTGTTTTGACTGGTCACGAAGAT
GCCTCAATAAAACTTTGGGATGTTAGAACTGGAGCATCTGAAAAGAAATATAAAGCTTCT
TTCGAAGGACATAGCAGCTGGATCTCTCAGGTCAAATTTAACAACAACGTAGAAAACTTA
TTCATCTCAGGCTCCTATGATGGTACTGTCAAGATGTGGGATATAAGAAATGAAGAAATG
CCATTAGCTACTCTCAAAAGGAAAGGTGATGCCAAAGTTGATGATTACAAAGTCTTTGGA
GTTGAGTGGAACGGTGCTTCTCAAATTCTTAGTGGTGGTTCAGACTCCAATATTTCTGTT
CACACAATTGCTTGA


>Contig4281.0.g49(protein)
MNKTAGVVSADKQMTSEVQVTFKTNLPEEYQVPEVFISIATGSTNKELTQILKQLMSEDN
VDIKGKKFNFMINSVFITTTVQDLFDKLGLQNEEGVEIYYQFALDKPKPTHSIPQDEWIS
TIRSLSHIMNEKAKTYIVGFFNGDVKVFSKNDHQELLNIKQLHQDSMIQDALFLKNDLLD
KKIVVTCSNLPQSELRIGEITQVNGKFGYSQIAQSRESDYGNINDGFKCLSSNPMNNEYI
CSAYTSSEQAPEKAILIWRMNKHTLEGDSSQNQIKSQGGMKRVKTNIAYIGSHSQIVCNG
GVQCMKWATPEKIYVGSNDHSVKIINVEKQAIEEVMFTNYKVPTCIDSAQDSLVLTGHED
ASIKLWDVRTGASEKKYKASFEGHSSWISQVKFNNNVENLFISGSYDGTVKMWDIRNEEM
PLATLKRKGDAKVDDYKVFGVEWNGASQILSGGSDSNISVHTIA