Identifiers and Description

Gene Model Identifier

Contig13512.0.g60

Standard Name

WDD1

Aliases

Contig13512_0_g60

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00400 ) WD domain, G-beta repeat
  • ( pfam03178 ) CPSF A subunit region
  • ( pfam03989 ) DNA gyrase C-terminal domain, beta-propeller
  • ( pfam02239 ) Cytochrome D1 heme domain
  • ( pfam00652 ) Ricin-type beta-trefoil lectin domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008366409.997093137033517e-262hypothetical protein
SGDYBR198C0.000000000003998907168546896TAF5 SGDID:S000000402, Chr II
from 618523-616127, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13512.0.g60(coding)
ATGCAAATGAAATAAGAACAGGAATTGCCAAAGACAAGCAATTCAGCTGGCATGAAGCCA
GTTGTTTCAAGTGATTAAGTGGAATTAGATCACGCCATAGGATTTAGCGGCAAGCTTGTG
AACAGTGTATTCTTGCATCCTAACGCTAAAGACTATGTTCTTATTGCAGGTTGTAGCGTT
GTTGTTGGCGATTTAAGCGATCCTCATAATTAGAATTTTCTAACTGCCCACGATGACTAA
ATTACTAGTTTAGCAATCTCAAACACTGGAGCATTCCTTGCATCTGGGTAAAGAGGAGAT
AACTCTGATATTGTTTTATGGGACTATTCCACAAAAAGAGCACTGTTCCGTTTGTCTGAG
CATGACCACGAAGTAACGCATCTAGATTTTTCACATGATGACCGTCTACTTATATCTACA
GGCAATTAGCTTGATGGGAAAATGTTTATCTGGAACACTTCAAATGGTTTTATTGTATCA
TCTGTGCAAGTTATACCCTCTATATTTGCTGAATCACCAAGATGCATCAGTTGGGGAGGC
TTTGTTAAGGATATCAAGTTAAGACCAACAAACAAATATCAATTCGCAATGAGTGGCTCC
AAGAAGCTAGTTCTATCTTCTCTTGATCCAGCAACAGGTTTAACAACAAACGATTTAGTT
AACACAGGAGCGTTTATGAGAGACTACTAATGCCTTGTTTTTAGCAAGCCAACTGAGGAA
TTTTTGTATGCAGGAACATCATCTGGAGACTTCTGCTGCTTCTAAGTTAAGAATAAAATG
TTAGTCTTTACTCAAAACGTGTGTGCTCAAGGTATTAAGTGTATTCAGGCAGTTACTACA
GACAAGATTTGTGTCGGAGGTGGAGATGGCCAAATTGTTCTCTTTCATGTTGATCAAAAC
TTCTGTTAAGCTCTTCTTAAAACACAAATATTTGGCGCTATTCATGGCCTATCTTCTAGT
CAGGATGGAATTTAAATTTTAACAGCAACTGACAAAGGTTATATCTACAGACTTAGAGTA
AGTGACTTCTCAAAGATGTTATTATGTGAGAATCATACAGAACCAGTTCTTGATGTTACA
TATATGAATGGTATATCTGATAAATTTGCTACATGCTCTGAAGACGGTTCAGTAAGACTT
TGGGACAGCAATGACTATTCTGTAATATCAAGATGCACAATTTAGACTGCTGGAGTAGTA
TTTCCAAATTGCTCTACTTTTACAGATGAAGTTATAATTTCTGGGTGGAACGATGGTAAA
ATAAGATCTTTCAAAGTTGATGGATCATCTCCTCTATGGTAAATTGATAATGCCCATAAA
AATGGTGTTACAGCTATATGTCTAAGTTATAACTCTAAGTTTATATGCTCTGGAGGTAAT
GAAGGTGAAGTCAGAGTTTGGGAAATCAGATCAAGAGAACTTGTCTCGCATTTGAAAGAG
CACACCAGTAGAGTTACCAAAGTTTAGGTTTTCCCAGATGACATACACATGCTTACTTGT
GCAAGAGACAAAGCAATCTTATGTTGGGATCTTAAAAACGAAAAAAGAGTAGCAAACTAA
ACTTAGAGAATGGGTGGTGTTAACTGCTTCAGTATTGCACCCAACGATAATAACAAATTT
ATGAGTGTTGGGCAAGAAAGAAAAATCACTTACTGGGACTTGAGAAAAACACAACCAGAG
ACTATTTTAGAAAGCAGCCCATATAGAGGAGAATCAGATGAGTTAATATCAGTTTGTATC
TCACATAACAATAAATACTTCGTAACTGGTGGTCAACTTGGTATTGTTAGAATATATGAT
TATACAAATGGTTCTTTCATTACTGAGTGCAGAGCACATTCAAGCTCAATCACATGTGTT
AAATTTTCTCCAGATGATAAACAGATTGTTAGTACTGGCAGAGATGGATTAATAGCTGTA
TGGAACTATTTCTTGTGA


>Contig13512.0.g60(protein)
MQMKQEQELPKTSNSAGMKPVVSSDQVELDHAIGFSGKLVNSVFLHPNAKDYVLIAGCSV
VVGDLSDPHNQNFLTAHDDQITSLAISNTGAFLASGQRGDNSDIVLWDYSTKRALFRLSE
HDHEVTHLDFSHDDRLLISTGNQLDGKMFIWNTSNGFIVSSVQVIPSIFAESPRCISWGG
FVKDIKLRPTNKYQFAMSGSKKLVLSSLDPATGLTTNDLVNTGAFMRDYQCLVFSKPTEE
FLYAGTSSGDFCCFQVKNKMLVFTQNVCAQGIKCIQAVTTDKICVGGGDGQIVLFHVDQN
FCQALLKTQIFGAIHGLSSSQDGIQILTATDKGYIYRLRVSDFSKMLLCENHTEPVLDVT
YMNGISDKFATCSEDGSVRLWDSNDYSVISRCTIQTAGVVFPNCSTFTDEVIISGWNDGK
IRSFKVDGSSPLWQIDNAHKNGVTAICLSYNSKFICSGGNEGEVRVWEIRSRELVSHLKE
HTSRVTKVQVFPDDIHMLTCARDKAILCWDLKNEKRVANQTQRMGGVNCFSIAPNDNNKF
MSVGQERKITYWDLRKTQPETILESSPYRGESDELISVCISHNNKYFVTGGQLGIVRIYD
YTNGSFITECRAHSSSITCVKFSPDDKQIVSTGRDGLIAVWNYFL