Identifiers and Description

Gene Model Identifier

Contig18347.0.g89

Standard Name

WBSCR27c

Aliases

Contig18347_0_g89

Description

Methyltransferase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam13847 ) Methyltransferase domain
  • ( pfam13489 ) Methyltransferase domain
  • ( pfam12847 ) Methyltransferase domain
  • ( pfam08241 ) Methyltransferase domain
  • ( pfam01209 ) ubiE/COQ5 methyltransferase family
  • ( pfam05175 ) Methyltransferase small domain
  • ( pfam08242 ) Methyltransferase domain
  • ( pfam13649 ) Methyltransferase domain
  • ( pfam06325 ) Ribosomal protein L11 methyltransferase (PrmA)
  • ( pfam13679 ) Methyltransferase domain
  • ( pfam13659 ) Methyltransferase domain
  • ( pfam00398 ) Ribosomal RNA adenine dimethylase
  • ( pfam05219 ) DREV methyltransferase
  • ( pfam01135 ) Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)
  • ( pfam08003 ) Protein of unknown function (DUF1698)
  • ( pfam06265 ) Protein of unknown function (DUF1027)
  • ( pfam07757 ) Predicted AdoMet-dependent methyltransferase
  • ( pfam03291 ) mRNA capping enzyme
  • ( pfam10294 ) Putative methyltransferase
  • ( pfam00435 ) Spectrin repeat
  • ( pfam12948 ) MSP7-like protein C-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008036000.00010003404299092957ubiquinone biosynthesis O-meth
yltransferase f...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18347.0.g89(coding)
ATGGAACAGCAACATTCCACTCAACAAATCTCAGAAGAATTGAGACAAGAAATGCTGAAG
CATACTGGCTTCTCCCAAGATCAGATCAAGGAGCACTACGACGAGGTAGCTGAGAAATAC
GATTAAATTTATTTAAATGCTGGCTATCATGATCATGAACACACAGCACAGCTTGTGAAT
AAGTTCTATGCAGACAACAAAGACATCGAGATCTTAGATATGGGATGTGGAACTGGTTTA
GTGGGTGAGGAGCTCAAGAAACTTGGTTACAACAAGATCGTAGGTATTGACGCCAGTCAA
GGTATGCTTGACACTGCTTCTAAAAAGCTTGCTTACCACTAATTGGAGGAGCTTTTCCTA
GGAAAGCCTGATTCTTTCCCTGAAAAGTTCAGAAGCAGATTTGAGATAATCACTGCCTCA
GGAATTTTGGCTCAAGGTCACTTGGGTGTAGAGGTCTTTGAAGAATTCCTCCTGGCTTTG
AAACAAAACGGTGTCGCAGTATTCACAACCAGAACTATGTACTTAGAGGAATATGGATAT
GGAAAGAGAATGCAAGAGATCGTAGATGAAGGCAGATGGTAAAAATTAGATGAAGTTGCT
TTCGATAGATACGATAACCTCGGAGATGAGAAAGTAGGCAGATACTAAAAAGTAGAAGTC
AGAGCATTTGCTTACAAAAAACTATGA


>Contig18347.0.g89(protein)
MEQQHSTQQISEELRQEMLKHTGFSQDQIKEHYDEVAEKYDQIYLNAGYHDHEHTAQLVN
KFYADNKDIEILDMGCGTGLVGEELKKLGYNKIVGIDASQGMLDTASKKLAYHQLEELFL
GKPDSFPEKFRSRFEIITASGILAQGHLGVEVFEEFLLALKQNGVAVFTTRTMYLEEYGY
GKRMQEIVDEGRWQKLDEVAFDRYDNLGDEKVGRYQKVEVRAFAYKKL