Identifiers and Description

Gene Model Identifier

Contig10139.0.g94

Standard Name

WBSCR27b

Aliases

Contig10139_0_g94

Description

Methyltransferase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003055900.0000020007268868677913methyltransferase, putative
SGDYBR034C0.0000020007268868677913HMT1 SGDID:S000000238, Chr II
from 305976-304930, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10139.0.g94(coding)
ATGTCAAAGCCTGTTGTAACAGAAGAAATGAAAGAGAACATGCTCAAGCATGGAGGATTC
TCTCAAGACCATATTGCAGAGCATTACGATGAATTGAGTGCCCATTATGAACAGATCTAC
TTGACTGCCGGCTACCATGATCCATTGAGATGTGCTGAACTTTGCAAGGAAATCTTTGGT
GATGCAGCTGCTGAGGCTCAAATCTTCGATATGGGTTGCGGTACCGGTCTCGTTGGACAA
TATCTTAAGGAGAGAGGATTCAAACACGTAGTTGGTGTTGATGCCAGCGCAGGTATGTTA
GAGAAAGCAAAGGAAAAAGAATCTTATGAATCTCTCCAGGAGCTGTTCTTGGGCAAACCA
GATACCTTCCCACAAGAGTTCAGAGGTAGATTCGATGCTATCACTGCCGCTGGAATCTTA
GCCGAGGGTCACTTAGATAACAACGTCTTCGATGAAATGCTATTAGCACTTAAAGATAAT
GGATATGCCATCTTTGCCACAAGAACCATGTATTTAGAGTAATACAGCTATGGTTTGAAG
ATTAAGGAGCTAGAAGATCAATAAAAATGGAAACTTATTAAAGAAATCACTTTCGATAGA
TACGATCAATTAGAAGAAGCAGTTGGCAGATTCTCAAAGGTTGAGATCAAAGGTTTTATT
TATCAAAAACTATGA


>Contig10139.0.g94(protein)
MSKPVVTEEMKENMLKHGGFSQDHIAEHYDELSAHYEQIYLTAGYHDPLRCAELCKEIFG
DAAAEAQIFDMGCGTGLVGQYLKERGFKHVVGVDASAGMLEKAKEKESYESLQELFLGKP
DTFPQEFRGRFDAITAAGILAEGHLDNNVFDEMLLALKDNGYAIFATRTMYLEQYSYGLK
IKELEDQQKWKLIKEITFDRYDQLEEAVGRFSKVEIKGFIYQKL