Identifiers and Description

Gene Model Identifier

Contig10139.0.g93

Standard Name

WBSCR27a

Aliases

Contig10139_0_g93

Description

Methyltransferase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam13489 ) Methyltransferase domain
  • ( pfam08241 ) Methyltransferase domain
  • ( pfam13847 ) Methyltransferase domain
  • ( pfam12847 ) Methyltransferase domain
  • ( pfam08242 ) Methyltransferase domain
  • ( pfam13649 ) Methyltransferase domain
  • ( pfam05175 ) Methyltransferase small domain
  • ( pfam01209 ) ubiE/COQ5 methyltransferase family
  • ( pfam07021 ) Methionine biosynthesis protein MetW
  • ( pfam06325 ) Ribosomal protein L11 methyltransferase (PrmA)
  • ( pfam13659 ) Methyltransferase domain
  • ( pfam03848 ) Tellurite resistance protein TehB
  • ( pfam05891 ) AdoMet dependent proline di-methyltransferase
  • ( pfam13679 ) Methyltransferase domain
  • ( pfam08003 ) Protein of unknown function (DUF1698)
  • ( pfam01728 ) FtsJ-like methyltransferase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003055900.000050024383570459175methyltransferase, putative
SGDYBR034C0.00020003864201578029HMT1 SGDID:S000000238, Chr II
from 305976-304930, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10139.0.g93(coding)
ATGCTAAACTTTGAAGGTGAATTGACCGCTTAACACAAAGAAGAGATGCAAAAGCACGGA
AACTTCTCTCAAGAAAACATTGCTGATCACTACAACGAGTTGAGCTCTCACTACGAAGAG
ATCTACCTCAGAGCAGGATGGCACGATCCCCTAAAGTGCGCTGAACTCGCAAAGACATGC
GTTGGTGATGCCGCTGAAGCAGCTGTTGTACTCGATATGGGATGTGGTACTGGACTTGTT
GGCCAATATCTAAAGGAGAGAGGCTTCAACCAAATAGTAGGTGTTGATGCCAGCGCTGGT
ATGTTAGAAAAGGCAAAGGTCAAGGGCTCATACACTGAACTTCACGAACTTTTCCTAGGA
TTACCAGACACTTTCCCAGAGAACCTTCACAATAGATTCGATGTTATCACTGCAAGTGGC
ATCTTGGCTGAAGGTCATCTTGACAACAAAGTCTTCGATGAAATGCTTATGGCCCTTAAG
ACCGGTGGCTATGCTGTATTCGCCACCAGAACTATGTACTTAACTCAATATAACTATGTC
GAGAAGATAAAGGAACTCGTAGACACTGGAAAATGGAGTCTTGTTAACGAGATCACTTTT
GATAGATACGATCAACTCGAAGAAGCTGTTGGCAGATTCCAAAAGGTTGAAGCAAAAGCA
TTCGCTTACCAAAAACTCTGA


>Contig10139.0.g93(protein)
MLNFEGELTAQHKEEMQKHGNFSQENIADHYNELSSHYEEIYLRAGWHDPLKCAELAKTC
VGDAAEAAVVLDMGCGTGLVGQYLKERGFNQIVGVDASAGMLEKAKVKGSYTELHELFLG
LPDTFPENLHNRFDVITASGILAEGHLDNKVFDEMLMALKTGGYAVFATRTMYLTQYNYV
EKIKELVDTGKWSLVNEITFDRYDQLEEAVGRFQKVEAKAFAYQKL