Identifiers and Description

Gene Model Identifier

Contig4343.0.g46

Standard Name

WARS2

Aliases

Contig4343_0_g46

Description

tRNA synthetases class I (W and Y)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00579 ) tRNA synthetases class I (W and Y)
  • ( pfam01746 ) tRNA (Guanine-1)-methyltransferase
  • ( pfam14433 ) SUKH-3 immunity protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009976101.999469658314961e-75tryptophanyl-tRNA synthetase f
amily protein
SGDYDR268W3.998181939598921e-51MSW1 SGDID:S000002676, Chr IV
from 1004004-1005143, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4343.0.g46(coding)
ATGGAATCTACAATAGCTTCCACTGTATAATCAGATCCCCAAGATAACTAATAAGATCTG
TAACAAACATCCGTCATAACTGATCAAAACGGAGAAGTAATCTCTACTTTATCTAAGCGT
AAAATGAAAAAACTCGCCAAAGAACAAAAATGGTTGGAAAAAAAGGCTTAAGATAAAGAA
AGTGGTATTCACAAAAAGAAACATAAGAAGTCTCAAAGTACATACGCTCATTTATCTCGC
TTTAATAGTGCAAATCAGATTAAAGCTGAGGAGGGAAGTGATTAATAAAAATTAGAGAGT
CAGAGAGAACCAGGGCAAGAAGGCGTTATGAAAACAAGCAAGAAAGAGAAGCAATAGATG
TTTAGGGAATTGTGTCAGAAAGGTCCTAAATACATAATTGATTGCGAGTTTGAAGATTTG
ATGCAGGATAGAGAGCTGAAATCATTATCATAATAGTTGGCTTATTGTCATTCAGTCAAT
AAGAAAATGGATTAACCATTGAATATTTTAGTAAGTGGAATTGATGGAAAACTAAAAACT
ATGATTGAAAAGAGCAACTGTCAAAACTGGGCAGTGGATATAAAGTACAGCACAAAATAT
ATAGATATAGTAGAGGATAAAAGTAAGCTTGTATATTTAACTGCAGATAGTGAAAATCTA
ATTGAAACATTAGATGATTAGATGACTTATATAGTTGGTGGCATTGTGGATCATAATCGA
TACAAACTTTTAACTTATAAGAAAGCCACAGAGTAAGGTATTTAACATGGAAGATTGCCT
ATAAGAGAGAATGTTTAATTGACTCATTCAGCTGTCCTGACTGTAAATCATGTATTCTCA
ATAATTGCAGCTTACTATAAACATAATGGCGATTGGAAAAAAGCTCTGACAGAAGCCATA
CCTGAAAGAAAAAGAAAAGCTCTAGAAGAAGTTAAAGACGGTGAAGAGATTCAAAAAGAA
GAGGAGAAAGAATACCGTAAACACATCATAAAAATGAAGAAAGCTGCTAAGAATATCGTT
TTATCTGGAATCTAACCTTCTGGTTTTATCCATCTGGGGAACTACCTAGGTGCTGTACAA
AACTGGGTTTAGCTCTAAAATTAAGCTGATATTCATCAGAGATTCTATTCGGTTGTGGAC
TATCACTCTTTAACTCAAAAATATGTGGGTGTAAGAGACGATGGAGATGGAAAAACGCTC
CCTGGCTCTCCAATTATAGAGGAAGATGAAAAGCCAAAGGAAGATAGCCCCTAAGAGTTA
ACTCTGAAAACAGCAGCAACCTTATTGGCATGTGGTATAGATCCAGCAAAGAGCACTCTC
TTTGTACAGTCTCATGTGCCTGCAATTACAGAACTGCTGTGGTTCTTATCATGTTTAACT
CCTCAAAGCTGGCTGAATAAGATGATTCAGTATAAAGAAAAGAAAGGGTCCAAGAGCGAT
AAACAGACAAGTCTCTCGCTATATTCCTATCCAGTTTTAATGGCTGCTGATATCCTAGCA
TATAGAGCTAATTTAGTGCCTGTAGGTGAAGACCAGACTTAGCATTTGGAATTAGCTAGA
GATATTGCTGAAAGATTCAATAAGCTATTCGAAGAGCCTGAACTATTTCCACTCCCAAAT
AAATTAGATTATGAACATAGCTTGTTTGTTTACAACAGAGTAATGAGTTTGTAAGATGCT
TCTAAGAAAATGAGTAAGAGCGATAAATCACTTAAATCTTGCATTAACTTAATTGATGAT
CCAGAAATGATTAGACTCAAAATTTCTAAAGCTAAGACCGATTCACTTGGAAGGATAAAG
TACGATACATCAAGGCCAGAGTTACTAAACTTGCTACACATTTATGCAGCAATAGAAGGT
CAAGATGTTAGAAAGATTGATGTTCTCTTTGAAAATGATAACATGTACTCTTTTAAAGAA
AAACTTAGTAATAAACTTATCGATAAACTCTGCCCTATTGGTGAGAAAGCACTAGACTTA
TGCGCAAAAAACGAAGACTATCTTCTTGATACTCTTGATAAAAGTGCAATCGAAGCAAAT
AAGCATGCTGAGAATACACTAAGATTAATGAAGGCAAAAGTTGGAATTCTAAGAAGAAAT
TTATGA


>Contig4343.0.g46(protein)
MESTIASTVQSDPQDNQQDLQQTSVITDQNGEVISTLSKRKMKKLAKEQKWLEKKAQDKE
SGIHKKKHKKSQSTYAHLSRFNSANQIKAEEGSDQQKLESQREPGQEGVMKTSKKEKQQM
FRELCQKGPKYIIDCEFEDLMQDRELKSLSQQLAYCHSVNKKMDQPLNILVSGIDGKLKT
MIEKSNCQNWAVDIKYSTKYIDIVEDKSKLVYLTADSENLIETLDDQMTYIVGGIVDHNR
YKLLTYKKATEQGIQHGRLPIRENVQLTHSAVLTVNHVFSIIAAYYKHNGDWKKALTEAI
PERKRKALEEVKDGEEIQKEEEKEYRKHIIKMKKAAKNIVLSGIQPSGFIHLGNYLGAVQ
NWVQLQNQADIHQRFYSVVDYHSLTQKYVGVRDDGDGKTLPGSPIIEEDEKPKEDSPQEL
TLKTAATLLACGIDPAKSTLFVQSHVPAITELLWFLSCLTPQSWLNKMIQYKEKKGSKSD
KQTSLSLYSYPVLMAADILAYRANLVPVGEDQTQHLELARDIAERFNKLFEEPELFPLPN
KLDYEHSLFVYNRVMSLQDASKKMSKSDKSLKSCINLIDDPEMIRLKISKAKTDSLGRIK
YDTSRPELLNLLHIYAAIEGQDVRKIDVLFENDNMYSFKEKLSNKLIDKLCPIGEKALDL
CAKNEDYLLDTLDKSAIEANKHAENTLRLMKAKVGILRRNL