Identifiers and Description

Gene Model Identifier

Contig20174.0.g34

Standard Name

WARS

Aliases

Contig20174_0_g34

Description

tRNA synthetases class I (W and Y)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00579 ) tRNA synthetases class I (W and Y)
  • ( pfam13108 ) Protein of unknown function (DUF3969)
  • ( pfam01956 ) Integral membrane protein DUF106

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005008901.000444791949842e-158tryptophanyl-tRNA synthetase f
amily protein
SGDYOL097C9.998919090800975e-129WRS1 SGDID:S000005457, Chr XV
from 137825-136527, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20174.0.g34(coding)
ATGGAAACTACTTAGTAAGTATAAGACCAAACTGTTCCTATTGAAGAACAAAAGATTGAT
GTCATATCTTAAGACATTACTTAAGACTAAAAATTAGAGAAAGAAGACAACGTTACAGCA
TTTAAAATTGAGGCAGCAACAGATAAAGGAATAGACTACGATAAACTTCTTGTCAAGTTC
GGTTGTTCAGCAATGAATGATGACTTAAAAGCCAGAATTGAAAAATTAACTGGATAAAAA
CCTCATAGATTCATTAGAAGAGACATTTTCTTCTGCCACAGAGATTTAGACGTCATATTG
AAGAGATACGAAGAAGGTAAACTGTTCTATTTATATACTGGAAGAGGACCATCTGCTGAA
GCACTACATATGGGTCATGCTATTCCATTTATTATGAACAAATATCTTTAAGACGCATTT
GATGTACCTCTCGTCATTTAGATCACTGATGACGAAAAGTATCTATATAGACCAGAGTAC
ACTTTAGAGCAAATTCAAAAGATGTCTATGAGCAATATTAAGGATATTATTGCATTCGGT
TTTGATCTTGATAAGACTTTCATCTTCTAAGACACTGACTATATTCATCACTTGTATCCA
AACACCCTCAGAGTTCAAAAGCACACTACTCTTAACTAATTGAAAGGATGCTTCGGCTTT
AATGATTCAGATAATGTTGGTAAATTTGCTTATCCACCAGTTTAGGCTGTCCCCTCTTTT
TCAAATACTTTCCCACACATTTATGGAAAAAGAACTGATGTTCCTTCATTGATTCCTTGT
GCCATTGATCAAGATCCATACTTTAGAATGACCAGAGAGGTTGCAGGTAAATTGAAATAT
GAAAAGACATCATGCTTCTATTCAATTTTCTTCCCAGCTCTTTAAGGCTTAAAGACAAAG
ATGGCATCTAGTGATCCAAACAGCTCCATCCTCTTATCCGACTCCCCAGCTGATGTGAAG
AGAAAGATTAACAAAGCTTACTCAGGTGGTGGTTAAACAGTTGAAGAGCATAGAGCTAAT
GGAGCTAACTTGGAAGTAGATGTACCCTTCTAATGGTTAAAGTTCTTCCTTGAGGACGAT
GAAAAACTTAACGAAATCAAAGAGAAGTATGGAAAGGGTGAGATGATGACAGGTGAGGTC
AAGGCTATACTTATTGAATGCATCAACGCTTTCTTGAAAGAATTCTAAGAGAGAAGAAAG
AAGGTCTCAAATGAAGTTGTCAAGCAGTTTATGGAAATAAGAAAGATCAATCCAGTACCA
AAGAGATTTGAAGAAGCTAGAAAAGCAAAGGAGGAAGCAGAGAAACAGGCAAAGGAAGAA
GCAGAGAAGCTTGCCAAAATTTAAGCAGAAGAATCAAAGGAGCAATAATAACCACCTCAA
TGA


>Contig20174.0.g34(protein)
METTQQVQDQTVPIEEQKIDVISQDITQDQKLEKEDNVTAFKIEAATDKGIDYDKLLVKF
GCSAMNDDLKARIEKLTGQKPHRFIRRDIFFCHRDLDVILKRYEEGKLFYLYTGRGPSAE
ALHMGHAIPFIMNKYLQDAFDVPLVIQITDDEKYLYRPEYTLEQIQKMSMSNIKDIIAFG
FDLDKTFIFQDTDYIHHLYPNTLRVQKHTTLNQLKGCFGFNDSDNVGKFAYPPVQAVPSF
SNTFPHIYGKRTDVPSLIPCAIDQDPYFRMTREVAGKLKYEKTSCFYSIFFPALQGLKTK
MASSDPNSSILLSDSPADVKRKINKAYSGGGQTVEEHRANGANLEVDVPFQWLKFFLEDD
EKLNEIKEKYGKGEMMTGEVKAILIECINAFLKEFQERRKKVSNEVVKQFMEIRKINPVP
KRFEEARKAKEEAEKQAKEEAEKLAKIQAEESKEQQQPPQ