Identifiers and Description

Gene Model Identifier

Contig16006.0.g36

Standard Name

VWA1

Aliases

Contig16006_0_g36

Description

von Willebrand factor type A domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007215401.999002769139511e-37hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16006.0.g36(coding)
ATGGAAAGCCATTAAAACTTACCCGAAATAACTTTAAGATATTTCCCTTTGAAAGAGGAT
TACATCTATGCTTAATTGTCAACACAGATCCCAGAGAGACAATATCAAGCTCTGACTGGT
ATCACACCAGGTGAAGTTCAATCCAGATCAAGCAAGGGAAGATCACTGATCTTATGCTTC
GATAAGAGTGGATCAATGTCTGGAATGCCTTACACAGCCTTACAAAAAGGTGCTTAAATG
ATTGGAGAATCAATCTTTGGGAGTAACGACTACGAAAGTATTGGAGTTTGTTACTATAAC
GATGGTGTCACTACTGGAAGATATGATGGAAAGCCATCTGATCTTATTAACTATCAAAAT
TTCTGCACAGGAAATAGAGCTGGAGGAAGCACAAATTTTGTAGCTGTTTTTAACTTCATC
AAGAAATTTACTGAAAGTAACGTTGTTCAGGATCTATCAATCATCTTCTTCACAGACGGT
CAAGATACTATGAACAATAAGTCAACCATAATGAAGTCTTTGGAGATCTTGAATAAGAAT
CTTGAAGCAAGCCATATAAATACAAGATATTTGACAATCGGTTTTACTTCATCTCATGAT
GCTCCATTCTTGAATGATATCGCAAAATCAGGAACTGAGCTCGGAAACTTCTTCTATATC
AACACAGATCAAGGTGATTACTCTGAATAGATCCAGAACTGTCTCGCTTAGTCACTCTCT
ATGGCATAATCTCAAGAAGGATTATTGCTAAGAGTCTCATCTAACTGCATGGAGTATAAG
GATAAGTTCATTCTTGAGAAGAATCTTGTGATAGATGATGACGAGGAGGTAGATGAGTAA
ACTGGAGAAATCAAGCAAAAGAAGATTGAAGGCCCTAAAATGCTTGACTTTACTGCTTAG
ACTTTGATAAAAGAAGCTGTTCTTAATGACATTGAATCAATTTTAGTTTTGCCAACTAGA
GAAGAGAAGGTCAAATTCAGAATTGAGTTGGTAGAGAATCCATCTCCAGAGGTTTTGGTC
AAGGCTTAAGTTCAACTTGTTAACAAACTTATTTTCAATTCAATTCAAGAAGTGCAAAAA
TCATAGAGTGGAAGAACTTCACAAGATATCTATGAAGAAGTCAACCTTCTTGATAAGCAA
CTTGATACATTCATTGAAATGGCAATGAAGATCAAGGATAGAGAAATCAAGAAGGAAATT
ATGGAGGAGATTTCAGAGTGCAAAGGAAAAACTATTCAAATTATTGAGATGCTCAGAAAT
GCAACTGGAAGAATCAATAATGCTCAGATTGCTTAATTAAACGATTTGGCATACAGAGCT
GTAAGAAAGAGAGGTCTATAAAAGAAGCTTGACGAAAGGGCTGTTAAAAATGAATAGTTT
TATAAGAAACTAGATCAACAACTCAAGGAAACAACTAAAAAGTTTGATTTCAAGGAACTA
AGAGAAAAGCACAAAGAACTTATTGATATCGTGGGAAGCTGCCCATTGTCATGCAATGAT
ATGATAGAAGCACTTGAGATGTAAGATTGTATGTGCTTGGGCTTAGATATTGGAAGATCA
GAGGCTGCAGTAGCTGACCCAACTAGACTTGTAATTAAGGACATTATCCCAACATTTATG
ACAGCTGACAGTTTCTTGGACTCATCTGCATTCTAAATTGGAAGAAATGACATGGCTCAT
GGAGGTTTTGATAAATCTACTTAGGGAAACTTAGCTATGGGACTTGGTAGAGAAAACATT
ACAGGAGTAATGCCACTTTATCTCTGTCACGAGCATTGGGAGATTGCTAGAAGAAAGGCT
CCACCTGTATATGGTTTCATGTGTACTCTTGATATCATGGGCTATACTTCTTCTCAATAC
TTCACTGTTCCATATTTAGTCTTACTCAAGTCAATTGAGAAGGCTGAGACTGAAAACAAG
TAAGTTTTTCACCAAATTTAGAAGCTTGTTCTTGAAACTTGCAAGAATATGATGACTTTC
AATGAATAGCACAGAATATAGATTATTGAGTTGATTACTAACTTCCTAGCTGGTCCAGAG
TTTAGAACAGCCGATATTGTAGCATCAATTCCAGTCATGCTTTCTCAACTTTACGTTTTG
ACTTAGCTAGAGAACTATCATCAATATTTCAAAGAAGAGTAACAACTTGACCTTGCTAAG
ATTCAAAAGTTAATAAGATTTGCCTTTGAAGAGCACTTAAGAAGATGTCTTAAGTCTGAT
GCTCAACCTCTTGAAAAGAGCAACATCCTAAACGTTCTTTATCCAGATTACGAAGCAGCG
GTCTCTGAAGTAATGGCTGCTAAGGACAAAGAAGTTTAAGCTGAATTTAAGGCTGGTCAA
GCTAAAGATGGAGGTGATAACAAACTAGCAATTTTCCAAGCTTAAGCAGATTACTTCAAA
TCCCTAGATAAGGATAACCTTCCAACTACATAAATTGTTGAAGAGGAAAAGAAAGAAGAG
TAGAAAGGCTAAGCTAAGGCAGTTTAAGTTGAGAAGATTGATCTCACAGCTAAGACTAAC
TAATTAGTAGCTTAAAAGCCATGGTTGTAGCAAATCGAAAAAGCTGATAGTTAAATTTAG
AAAATTCTTAATGGAACTGAGAGACACTTCAACAAGAAGAGTGTAGATTTAATTGCGATT
GCAAACCTCCTAGGAGTCTATCAAGACAAGAAAATTGAAAAGCTTAGTGAGATTCCATTT
ATTGAAGGGAACAAAGAAATCCTCTTAGCCATTATGTTCCAGAATATAATGCAGCCAAAG
AATCACTAGAGAAGAGACGCAATTGACTCAAAGCACTATATGGAAATCCATAATTAAGAG
GATGCTACCGCATATTTGACAAAGATTTTAACTTCAAACTTAAGAAATGAATTTTCTGGT
AGAGAGAGTGCTGTAAGAGCAAGTTTGCAAGGAGCCTTGTCAAGTGAATAAGCTATTCTC
TTCCTTGAAACACCAAATATTTACTATGCAGCTGCAGTTATGGTTCAAAGTGGATTCTAC
TTGGGTAGAGGTGACAGATCTCAAATCTTCCAGAAGATAATCAAGTAAGGCAACCAGTAC
GCTGTTATAAAGGAAAAGATTAAGATATTGCTCTCAGGACACTATCAAAATGAAAGATTA
TTTAAGGATAACATCAAGGATTATCCAGATGAATTCCACACAGGCAAATTTTATGAATAT
AGACTTTGGCTTGCTTTAGTCAGGTAGAAGCAAGTGTTGACTAATGATGAATATATTGAA
ATTTTCCCTGACGCCAAAGAAAAAGCTACAGTCTGGTTCTAATGTCTTGACTATGAAGGA
AAGCCAGTGAAAGAAAAGGAAACTTTCGGTAAATTTATTCAACAACGCCAAAAATAGAGA
AGAGACAACAAGCAAAAGAATAAAGCTCAAAGAGCCAAGAAGATGAAAATCTGA


>Contig16006.0.g36(protein)
MESHQNLPEITLRYFPLKEDYIYAQLSTQIPERQYQALTGITPGEVQSRSSKGRSLILCF
DKSGSMSGMPYTALQKGAQMIGESIFGSNDYESIGVCYYNDGVTTGRYDGKPSDLINYQN
FCTGNRAGGSTNFVAVFNFIKKFTESNVVQDLSIIFFTDGQDTMNNKSTIMKSLEILNKN
LEASHINTRYLTIGFTSSHDAPFLNDIAKSGTELGNFFYINTDQGDYSEQIQNCLAQSLS
MAQSQEGLLLRVSSNCMEYKDKFILEKNLVIDDDEEVDEQTGEIKQKKIEGPKMLDFTAQ
TLIKEAVLNDIESILVLPTREEKVKFRIELVENPSPEVLVKAQVQLVNKLIFNSIQEVQK
SQSGRTSQDIYEEVNLLDKQLDTFIEMAMKIKDREIKKEIMEEISECKGKTIQIIEMLRN
ATGRINNAQIAQLNDLAYRAVRKRGLQKKLDERAVKNEQFYKKLDQQLKETTKKFDFKEL
REKHKELIDIVGSCPLSCNDMIEALEMQDCMCLGLDIGRSEAAVADPTRLVIKDIIPTFM
TADSFLDSSAFQIGRNDMAHGGFDKSTQGNLAMGLGRENITGVMPLYLCHEHWEIARRKA
PPVYGFMCTLDIMGYTSSQYFTVPYLVLLKSIEKAETENKQVFHQIQKLVLETCKNMMTF
NEQHRIQIIELITNFLAGPEFRTADIVASIPVMLSQLYVLTQLENYHQYFKEEQQLDLAK
IQKLIRFAFEEHLRRCLKSDAQPLEKSNILNVLYPDYEAAVSEVMAAKDKEVQAEFKAGQ
AKDGGDNKLAIFQAQADYFKSLDKDNLPTTQIVEEEKKEEQKGQAKAVQVEKIDLTAKTN
QLVAQKPWLQQIEKADSQIQKILNGTERHFNKKSVDLIAIANLLGVYQDKKIEKLSEIPF
IEGNKEILLAIMFQNIMQPKNHQRRDAIDSKHYMEIHNQEDATAYLTKILTSNLRNEFSG
RESAVRASLQGALSSEQAILFLETPNIYYAAAVMVQSGFYLGRGDRSQIFQKIIKQGNQY
AVIKEKIKILLSGHYQNERLFKDNIKDYPDEFHTGKFYEYRLWLALVRQKQVLTNDEYIE
IFPDAKEKATVWFQCLDYEGKPVKEKETFGKFIQQRQKQRRDNKQKNKAQRAKKMKI