Identifiers and Description

Gene Model Identifier

Contig20650.0.g45

Standard Name

VGR1

Aliases

Contig20650_0_g45

Description

Herpesvirus polymerase accessory protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20650.0.g45(coding)
ATGAGTGAAGCAGCATCAAGCCCATCTGAAGCTTACAACCACTTTGTGAAGCTAAACCAG
ACTTTGTTGAACTGTTACGCAGACACCAATCCAATTCTCTATAGAATGATGAGCAATCAC
GAGCAAAAGAATTTCTGCTACAGCGAGAGACTTACTCTTGAGAACTATCTACAAAACGGA
AAAGTATCTCAAGCTGATTTCTTCAGAGCTGCCAGAGATGTCTGA


>Contig20650.0.g45(protein)
MSEAASSPSEAYNHFVKLNQTLLNCYADTNPILYRMMSNHEQKNFCYSERLTLENYLQNG
KVSQADFFRAARDV