Identifiers and Description

Gene Model Identifier

Contig2447.0.g21

Standard Name

VARS2

Aliases

Contig2447_0_g21

Description

tRNA synthetases class I (I, L, M and V)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00133 ) tRNA synthetases class I (I, L, M and V)
  • ( pfam08264 ) Anticodon-binding domain of tRNA
  • ( pfam09334 ) tRNA synthetases class I (M)
  • ( pfam10458 ) Valyl tRNA synthetase tRNA binding arm
  • ( pfam13603 ) Leucyl-tRNA synthetase, Domain 2
  • ( pfam00750 ) tRNA synthetases class I (R)
  • ( pfam01406 ) tRNA synthetases class I (C) catalytic domain
  • ( pfam00579 ) tRNA synthetases class I (W and Y)
  • ( pfam01921 ) tRNA synthetases class I (K)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004715309.997093137033517e-262valyl-tRNA synthetase family p
rotein
SGDYGR094W9.997093137033517e-262VAS1 SGDID:S000003326, Chr VII
from 672186-675500, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2447.0.g21(coding)
ATGGATATTCAAAGTGACGAAATGTTCAAGCTATTGAAAGTAAGAATGAGCGAGTGGTCA
TCAGCCGCAAAATTAGCATCATCAGTTGTTGCATAAACAAGTGCTGCATCTGTTTCAACA
AAGGCTAAAGCCAAGCCAGCTCAAAAGTAGCAAGAAGAGAAGAAAGAGTCAGCTGTTTTA
ATTCCAGATAACACACCAGCAGGAGAGAAGAAAGATATGAGCAATCCAATGGCTTCTGAG
TATGTGCCTAAGCAAGTTGAGGCTGCCTGGTATTCATGGTGGGAAAAGCAAAAGTATTTC
CACGCTGATGCTCAAAAAGTGCTCAATGATCCAGAAGTAAAGAAATTCATTATGGTTATC
CCACCTCCAAACGTCACTGGAGCTCTCCATTTAGGTCACGCTCTTATGTTGGCTATTGAG
GATTGCATTACTAGATGGAAGAGAATGTCCGGGTATGTTACTCTCTGGTTACCAGGTGTA
GATCATGCCGGTATTGCTACTTAATCAGTTGTCGAGAAACAACTCTGGAAAAAGGAAAAG
AAGACTCGTCACGACCTAGGCAGAGAAAAGTTCATCCAAACAGTTTGGGATTGGAAAGAT
GAGTATGGTGGAAGAATCAACAATCAATTCAGAAGATACGGTATTTCAGTTGATTGGGAT
AGATTTGCTTTCACTCTTGATGACCCTAGATCCAAGGCTGTTGTTGAAGCTTTCGTTAGA
ATGCACGATAAAGGTCTTATTTACAGAACTACCAGACTTGTCAATTGGAGTTCATCCTTG
AAAACTGCTTTGTCAGATTTAGAAGTTGAATTCATTGATCTTGAAGGTCCTACCTTCTTG
GCAGTTCCAGGTCATGACCCCAATGGCAAATATGAATTCGGTACTTTGACTGAATTCGCT
TACAAAATAAAGGGAACTGATAGAGAGATTATTGTTGCAACTACAAGACTAGAAACTATG
CTTGGTGATGTTGCTGTAGCTGTCCATCCTGAAGATCCAAGATACAAAGATTTGATTGGA
ATGGAACTAGAACATCCATTCATTCCAGACAGACATATGAAGATCATCGCAGACCCAGTT
TTGGTTGATATGAACTACGGTACTGGAGCAGTCAAAATCACTCCAGCTCACGATCACAAT
GATTACGCTTGCGGAAAGAGAAACGGCTTGACTAACATCAATGTGTTCGATGAAGATGGA
AGAATCAATCACAATGGAGGCAAATATGCTGGCTTGATGAGATTCGATTGCAGAAACTAA
CTCTTTAAGGATATGACTGAGATGGGACTTATTAAAGGTAAAAAGCCAAACAAGATGAGA
CTTGGTCTATGCTCTAAGAGTAATGACATCATTGAACCTTACCTTAAACCTCAATGGTAT
GTTGACTGCAAAGATCTTGCAAAGAGATCTTGTGACGCTGTAAGAAACAAGGAACTCTAA
ATTGTTCCAGAGCAACATGAGAAAGTATGGTTTGACTGGCTTGAAAATATTCAAGATTGG
TGTATCAGTAGACAACTATGGTGGGGTCACAGAATCCCAGCCTTTTTAGTGACCATTCCA
GGAGTCATTGATAATCCAGACACATAAAACGAAGATCATTACGTTGTTGGTAGAAACGAA
GAGGAAGCAAGAGCTAAGGCAGCATTAAAATTCAATGTCGCCCCTGAACTCATTAAGCTC
TCTTAAGATGAAGATGTTTTGGATACCTGGTTCTCATCAGGTCTCTTCCCCTTCTCAACT
CTTAACTGGCCTGATGAAGAGAACCCAGACTTCAAGGCTTTCTTCCCAGGTGATCTATTA
GAAACTGGTGGTGACATTATTTTCTTCTGGGTAGCTAGAATGGTTATGATGTCCTTGTGT
TTGACTGATAAACTCCCATTTAAGACCATTTTCTTACATCCTATGGTTAGAGATGAAAAA
GGTAAGAAAATGTCAAAATCCAAGGGTAACGTTATCGACCCCCTTGAAGTTATGGACAGT
TGCACCTTACAAGCTTTACTTGCTAAGCTATACGAATCAAATCTTCCAGAAGGTGAGATC
AAGGAAGCTGAATCTGAGAAAAAGAAAAAGTTCCCTCAAGGTATCCCAGAATGCGGTACT
GATGCTCTTAGATTTGGTCTACTTTCATACATGATTCAAAGCAGCATTAATTTGGATGTA
CAAAGAGTTGTCGGATACAGATAATTCTGCAATAAGTTATGGAACATTGTCAAATTCGCT
CTTACTAACCTACCTGAAGGATTTGTTCCAGAATAAAACGGTCCAGAAGGCTTAAAATTA
TCTCTATCAGACAAATGGATCTTAACTAGACTTGATAAAACTGTTGCCAACACTAACTAA
TTGATGGAAAGCTACAAATTAGGAGAAATGGTAATGGGACTTTATGATTTCTGGTTGAAA
GAACTTGCTGATGTTTACATTGAATCAATCAAGCCAGTTATGAAGGGAGATGATGAAGAA
GCTAAAAAGGCAGCAAGAAACACTCTATTCAGAGCTCTTGATTATGGTCTCAGACTACTT
CACCCAACTATGCCATATTTGACAGAAGAGTTATTCCAAAGACTTCCACACAGAGCTGAT
AACAGACCAGAATCAATCTGTATCGCTCCATTCCCAGAAAGTCATCTTTCATTCGCTCAT
GAGAACGTTGAAGACAAAAAGAGAGATTTACTTAATGCTGTTAAAGCTTTCAGATCTTAA
TTATCTGCTTTGAACGTAGCAAGCAACGCCAAGCCACATATCATCCTGAGATGCAGAACT
GAGGAGATCAAGCAAGTTTTCCACTCAGAAGGACATATTATTCAATCATTGGTTAAGAGT
GGTAAAGTCGAAATTCTAGGACCAAACGAACAAGACCCAGAAGGCTGCCTCAAGAATCAT
TTGAGTGAAGATTTCCAAACTTTGATTAAGGTTGTTGGTTTGATCGATGTCAAACTAGAG
ATTGAGAGAATAAATAAGAGACAAAACGAGTTAACTAAGCTTATGGATGGACAAAAGAAG
AAAATGAACATGCCAGGATATGAACAAAAGGTTCCTGAAAATGTCAGAAACGAAAACCAA
GAGAAATACAATACCTACAGCAGAGAATTCATTGAAAATGAGAAATCTCAAAGCGATCTT
GCCAAGTTCTTATGA


>Contig2447.0.g21(protein)
MDIQSDEMFKLLKVRMSEWSSAAKLASSVVAQTSAASVSTKAKAKPAQKQQEEKKESAVL
IPDNTPAGEKKDMSNPMASEYVPKQVEAAWYSWWEKQKYFHADAQKVLNDPEVKKFIMVI
PPPNVTGALHLGHALMLAIEDCITRWKRMSGYVTLWLPGVDHAGIATQSVVEKQLWKKEK
KTRHDLGREKFIQTVWDWKDEYGGRINNQFRRYGISVDWDRFAFTLDDPRSKAVVEAFVR
MHDKGLIYRTTRLVNWSSSLKTALSDLEVEFIDLEGPTFLAVPGHDPNGKYEFGTLTEFA
YKIKGTDREIIVATTRLETMLGDVAVAVHPEDPRYKDLIGMELEHPFIPDRHMKIIADPV
LVDMNYGTGAVKITPAHDHNDYACGKRNGLTNINVFDEDGRINHNGGKYAGLMRFDCRNQ
LFKDMTEMGLIKGKKPNKMRLGLCSKSNDIIEPYLKPQWYVDCKDLAKRSCDAVRNKELQ
IVPEQHEKVWFDWLENIQDWCISRQLWWGHRIPAFLVTIPGVIDNPDTQNEDHYVVGRNE
EEARAKAALKFNVAPELIKLSQDEDVLDTWFSSGLFPFSTLNWPDEENPDFKAFFPGDLL
ETGGDIIFFWVARMVMMSLCLTDKLPFKTIFLHPMVRDEKGKKMSKSKGNVIDPLEVMDS
CTLQALLAKLYESNLPEGEIKEAESEKKKKFPQGIPECGTDALRFGLLSYMIQSSINLDV
QRVVGYRQFCNKLWNIVKFALTNLPEGFVPEQNGPEGLKLSLSDKWILTRLDKTVANTNQ
LMESYKLGEMVMGLYDFWLKELADVYIESIKPVMKGDDEEAKKAARNTLFRALDYGLRLL
HPTMPYLTEELFQRLPHRADNRPESICIAPFPESHLSFAHENVEDKKRDLLNAVKAFRSQ
LSALNVASNAKPHIILRCRTEEIKQVFHSEGHIIQSLVKSGKVEILGPNEQDPEGCLKNH
LSEDFQTLIKVVGLIDVKLEIERINKRQNELTKLMDGQKKKMNMPGYEQKVPENVRNENQ
EKYNTYSREFIENEKSQSDLAKFL