Identifiers and Description

Gene Model Identifier

Contig13443.0.g103

Standard Name

UTP7b

Aliases

Contig13443_0_g103

Description

BING4CT (NUC141) domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001906209.997093137033517e-262Hypothetical
SGDYER082C2.000277046697593e-115UTP7 SGDID:S000000884, Chr V f
rom 325936-324272, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13443.0.g103(coding)
ATGGGAAAGGACAAAAAGCTATCAGCAGCCTTGAATAAAACTAAAGTTTTGACCGATGAA
ATCAAGCTTCGTCTTCAAGAATAAGATCAAATTTTTAACACTGAAGATAGAGGGTTTATC
GAAGTAGAGCATGAAAGAGAGAGAACTTTGAAAGTTTCTTAATAACAATTAAAGGACATC
TTGCCAGTTTAATCTGCCTAAAATATTTTTGATATCGGCCTCAATGAGTTTGGACCTTAC
GTCGGGCTTGATGTGACTAGAAATGGCAAAAATATTTTGTTAGGAGGAAAGAAAGGTCAT
GTCTCAGTTCTTGGCTGGAAAAAGAAGGATTTAAAGACTGAATTTCATGCCAAATAATTA
ATTAGGGATGTTAAGTTCTTACATAATGAGAAAATGTTTGCAGTTGCTTAGAAGAAGTAT
TTACACATATATGACTCACAAGGTATTGAATTGCATTGTATGAGAGATCATTAAGAACCT
AAGCTACTCGAATTCCTACCTTATCATTTCTTGCTAGTCTCTGCTTCTAAAATGGGTCAA
TTGAAATATCTTGATGTTTCCATCGGTCAAGTGATTGCCGAAATTAAAACTAAGCGAGGA
GAACCACTTTGCATGCATTAAAATCCTTAAAATGCAGTGATCTCAGTTGGACATAATTCA
GGAGAAGTTACTATGTGGACTCCTAATATGGGCTCAACCCCAGTAGTTAAAATGCTTTGT
CATCCATCAGCACCTGTCCTTTCACTTTCTATGTCAAGAGATGGCAGATACATGGTCACA
ACTGGAAAAGACTCAAAATTCAAAATATGGGATATCAGAAATACTTATCAAAGCGTTCAT
ACTTATTTCAATCCAGTGCCAGCAATCACTTCCACTTTCTCAGATACTGGCCTTGTAGGT
GTTGGTTTTGGTAGCGAAGTTCAAATCTGGAAGAATGTCTTTGCTGAAAAATAGAAAGCA
CCTTACATGAAATATAAGTTGGCAAATAAATCACATGTCTCGAAGGCACTCTTTTTACCA
TATGAGGATGTTATGGGAATTTCACATGATCAAGGCTATTCATCTATTGTTGTTCCAGGA
GCTGGTGAAGCGAACTTTGATGCATTTGAAGCTAATCCTTTTGAAACTAAGAAGCAAAGA
CAAGAAGCTGAGGTTCATAACTTGTTACAGAAACTTTAATCTGATACTATTTCCCTTAAA
GTAAACACCATAGGTATGGTTGATGATGCAGCTCCAGAAGTGAAGGCAAAAGAGCAACGT
GAGTTACAAGATGCATAAATAGAAAAAATGAGAAAGAAAGACAAGAAAAAGAACAAGATG
AGAGGTAAGGGCAAGATTGGCCGTGAAATGGAAAACAAAACTCATCAAGTTCATGAAGCC
ATAAGAGCTAAGAACAAGTTGCAATATGAAAAGGAATACAAGAAAGCAAAGGTTGAATAG
GATATGCTTCAAAACGATATGGAATTCCTTGATAAAATTGATGAAAAGTTTGATCCATTA
GAAAGTTATCTTATCAGCGAGAATAAAGGTAACAAAAGACAAAGGTTCTGA


>Contig13443.0.g103(protein)
MGKDKKLSAALNKTKVLTDEIKLRLQEQDQIFNTEDRGFIEVEHERERTLKVSQQQLKDI
LPVQSAQNIFDIGLNEFGPYVGLDVTRNGKNILLGGKKGHVSVLGWKKKDLKTEFHAKQL
IRDVKFLHNEKMFAVAQKKYLHIYDSQGIELHCMRDHQEPKLLEFLPYHFLLVSASKMGQ
LKYLDVSIGQVIAEIKTKRGEPLCMHQNPQNAVISVGHNSGEVTMWTPNMGSTPVVKMLC
HPSAPVLSLSMSRDGRYMVTTGKDSKFKIWDIRNTYQSVHTYFNPVPAITSTFSDTGLVG
VGFGSEVQIWKNVFAEKQKAPYMKYKLANKSHVSKALFLPYEDVMGISHDQGYSSIVVPG
AGEANFDAFEANPFETKKQRQEAEVHNLLQKLQSDTISLKVNTIGMVDDAAPEVKAKEQR
ELQDAQIEKMRKKDKKKNKMRGKGKIGREMENKTHQVHEAIRAKNKLQYEKEYKKAKVEQ
DMLQNDMEFLDKIDEKFDPLESYLISENKGNKRQRF