Identifiers and Description

Gene Model Identifier

Contig7145.0.g97

Standard Name

UTP7a

Aliases

Contig7145_0_g97

Description

BING4CT (NUC141) domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001906209.997093137033517e-262Hypothetical
SGDYER082C4.999238967328776e-115UTP7 SGDID:S000000884, Chr V f
rom 325936-324272, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7145.0.g97(coding)
ATGGGAAAGGACAAAAAGCTATCAGCAGCCTTGAATAAAACTAAAGTTTTGACCGATGAA
ATCAAGCTTCGTCTTCAAGAATAAGATTAAATTTTTAACACTGAAGATAGAGGGTTTATC
GAAGTAGAGCATGAAAGAGAGAGAACTTTGAAAGTATCTTAATAACAATTAAAGGACATC
TTGCCAGTTTAATCTGCCTAAAATATTTTTGATATCGGCCTCAATGAGTTCGGCCCTTAT
GTCGGACTAGATGTGACTAGAAATGGTAAAAACATTTTGTTAGGAGGAAAGAAAGGTCAT
GTCTCAGTTCTTGGCTGGAAAAAGAAGGATTTAAAGACTGAATTTCATGCCAAATAATTA
ATTAGGGATGTTAAGTTCTTACATAATGAGAAAATGTTCGCAGTTGCTTAGAAGAAGTAT
TTGCACATATATGACTCACAAGGTATTGAATTGCATTGTATGAGAGATCATTAAGAACCT
AAGCTACTCGAATTCCTACCTTATCATTTCTTGCTAGTCTCTGCCTCTAAAATGGGTCAA
TTGAAATATCTTGATGTTTCCATCGGTCAAGTGATTGCCGAAATTAAAACAAAGCGAGGA
GAACCACTTTGCATGCATTAAAATCCTTAAAATGCAGTGATCTCAGTTGGACATAATTCA
GGAGAAGTTACTATGTGGACTCCAAATATGGGCTCCACCCCAGTAGTTAAAATGCTTTGT
CATCCATCAGCACCTGTGCTCTCACTTTCTATGTCTAGAGATGGCAGATATATGGTCACA
ACTGGAAAAGACTCAAAATTCAAAATCTGGGATATCAGAAATACTTATCAAAGCGTTCAT
ACTTATTTCAATCCAGTACCAGCAATTACTTCAACTTTTTCAGATACTGGCCTTGTAGGT
GTTGGTTTTGGTAGCGAAGTTCAAATCTGGAAGAATGTCTTTGCTGAAAAATAGAAAGCA
CCTTACATGAAATATAAGTTGCCAAATAAATCACATGTCTCGAAGGCACTCTTTTTACCA
TATGAGGATGTAATGGGAATCTCACATGATCAAGGCTATTCATCAATTGTAGTTCCAGGT
GCTGGTGAAGCGAACTTTGATGCATTTGAAGCTAATCCTTTTGAAACTAAGAAGCAAAGA
CAAGAAGCTGAAGTTCATAACTTGTTACAGAAACTCCAAGCCGATACTATTTCCCTTAAA
GTAAACACCATAGGTATGGTTGATGATGCAGCTCCAGAAGTGAAGGCAAAAGAGCAACGT
GAGTTACAAGATGCTTAGATAGAAAAAATGAGAAAGAAAGACAAGAAAAAGAACAAAATG
AGAGGAAAGGGCAAAATTGGCCGTGAAATGGAAAACAAAACTCATCAAGTTCATGAAGCC
ATAAGAGCTAAGAACAAGTTACAATACGAAAAGGAGTATAAGAAAGCTAAGGTTGAATAG
GATATGCTTCAAAACGATATGGAATTCCTTGATAAAATTGATGAAAAGTTTGATCCATTG
GAGAGTTATCTTATCAGCGAGAATAAAGGTAATAAAAGACAAAGGTTCTGA


>Contig7145.0.g97(protein)
MGKDKKLSAALNKTKVLTDEIKLRLQEQDQIFNTEDRGFIEVEHERERTLKVSQQQLKDI
LPVQSAQNIFDIGLNEFGPYVGLDVTRNGKNILLGGKKGHVSVLGWKKKDLKTEFHAKQL
IRDVKFLHNEKMFAVAQKKYLHIYDSQGIELHCMRDHQEPKLLEFLPYHFLLVSASKMGQ
LKYLDVSIGQVIAEIKTKRGEPLCMHQNPQNAVISVGHNSGEVTMWTPNMGSTPVVKMLC
HPSAPVLSLSMSRDGRYMVTTGKDSKFKIWDIRNTYQSVHTYFNPVPAITSTFSDTGLVG
VGFGSEVQIWKNVFAEKQKAPYMKYKLPNKSHVSKALFLPYEDVMGISHDQGYSSIVVPG
AGEANFDAFEANPFETKKQRQEAEVHNLLQKLQADTISLKVNTIGMVDDAAPEVKAKEQR
ELQDAQIEKMRKKDKKKNKMRGKGKIGREMENKTHQVHEAIRAKNKLQYEKEYKKAKVEQ
DMLQNDMEFLDKIDEKFDPLESYLISENKGNKRQRF