Identifiers and Description

Gene Model Identifier

Contig22766.0.g53

Standard Name

UTP6

Aliases

Contig22766_0_g53

Description

U3 small nucleolar RNA-associated protein 6

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam08640 ) U3 small nucleolar RNA-associated protein 6
  • ( pfam13428 ) Tetratricopeptide repeat

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDR449C1.0004572433669413e-23UTP6 SGDID:S000002857, Chr IV
from 1358902-1357580, Gen...
T. thermophilaTTHERM_004186609.997764199084386e-16hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22766.0.g53(coding)
ATGGGAGATAAAGTAGACTTAATTTTGGAGAAAATGACTGATGAACTTCAGTATTACCTC
CAGCAAGAACTCTTCTCAAAGAAAGAAGTGAAAAAGATAGTGAAGGAGCGCAGAAACCAA
GAGTATAAAATGCAGAGAAAAGATGCAACACTTCTCTTTTTCTTAGATTCCCTGCAATTT
GAGAAAAAGCTTGATAAACTTAGACATAAAAGAAAGAGAGGTAAGGTTGGTCCAGAGGGC
AAAGGCAACATGAAAATAGTGTTGATGGACCACTCTATAAAGAAGAGAATCATGTACTTA
TATGATAGAGCCGTGAGAAAATTCAAAGAAAACATTGCCTTATAGAAGGAATACATGCAG
TATTTAGTAGAGAGCAGATCATTCCAAAAGCTAAATAGAGTGCTGGCTAGATCTGTCCAA
ATTCACCCACATAATTTAGATTTCTGGCTTATTGGCGTCTACACTGAGCTTGACATGAGA
GGAAACTTGTTTTCTAGTAGAAAGTTAATGCTATAAGCAATAAGAAACAATCCAAACAGC
GCATAGTTCTACGTTGAATACTTCAAGTATGAACTAAAGTTCTATGAGAAAATCTAATAA
AGAATACAAATTCTGAACGGAGGAGATGAAGAAAAGTAAAAACTTGAGGATGAGAAGAAA
ATTGATTTCATAATGGATGAGGAAGATGAAGAGGTCAAAAGTGAATTAAGCATTAACCAA
GGAAACGATATAGAGAAAGATCTAGATGCTGAAAAGGCAAGAGAAGATGGAAAGCATAGT
GGGTCAAGTAGACTTGTGGAAATTGTGTTTGACAATATTAATGAATAATTTGGAGAACAA
ATTCACATTCTAAAGTAATGTAAGGATACAGCAATGAGCAGCGATTTTCTAGATTAATAA
TTGAAAGATAAAATCAAGGCAATTTACTTAGAAAAAAAGAACAGTCCTAGTGGTAGTGAG
AGCTATATTTTAATGAAAATGAAAATTATTGGAGATGATTTGATTAAACTCTAAGTTTTC
ATTGAGAAAAACTCACAAAGATTTACAACAAAAGAAACAATAGAGATTGTAAAGCAGAGA
CTTGAAACATTGATAACTAAAGAAACTGATAACAATAACAAGAAAATCTTGATACATTTG
GTAATTGAATCAATTGGATTATCAGCAGATGAAAAGGCATCTGAATTATTCAAATATAAG
AAATACTTAAACCTTAAAGATAAAAAATTAGAATCTATGATTAAAAAGTATCTCGAATCA
TCAAGGAATCTTTTGAATCTATATCTCTTCGCTTTAACTTAAGATTAATGTCCCAAGGAT
CTTTTAACAGAGCTAGAATAGAAATCTTGGGATCATAAAACTTAGGATTTCCTTTTAATT
GGAAACGTTAAGTCCTATATTATGAAGGAAATGATTAAAATGGGTAGATAAAACCTGAGT
GAGGAATACTTAAAGAAATGTCTGCTATAATTCTCAGGTTTAGCTCAATTAAAAAGTCTT
CTTATTAAGAAATACTCAAACTTAATTAAGAAGTAATATGGTCAGCAAACAACAGAGGGA
GTTAAATACTTACTTGATCAAATTAAGAAAGCTTCATGTTTAATTGAAGACAAAGTTTAT
GATAATCTCATTCAGTCATTGCAGTTAAACAGCTAAATTTAAGTCAAGAAATCTTCATCA
TAAAACGATAATTAATTTGAGATTTATGAAATGATCTATGAGTCTAAATTGCATAATGGA
AACAACAAAGACAGCTAGGATGTATATTTGGAGTACATCAACTTCCTAGTAAATGTGGAG
AAGAATGAATAAAAGGCACTAAGTTTATACAACAAAGCTGTAAAAACCATCAAATCTAAC
TAGAGAGACCAATTCTTACAAAACTATAATGCCATACTTTCCAGGAGATGA


>Contig22766.0.g53(protein)
MGDKVDLILEKMTDELQYYLQQELFSKKEVKKIVKERRNQEYKMQRKDATLLFFLDSLQF
EKKLDKLRHKRKRGKVGPEGKGNMKIVLMDHSIKKRIMYLYDRAVRKFKENIALQKEYMQ
YLVESRSFQKLNRVLARSVQIHPHNLDFWLIGVYTELDMRGNLFSSRKLMLQAIRNNPNS
AQFYVEYFKYELKFYEKIQQRIQILNGGDEEKQKLEDEKKIDFIMDEEDEEVKSELSINQ
GNDIEKDLDAEKAREDGKHSGSSRLVEIVFDNINEQFGEQIHILKQCKDTAMSSDFLDQQ
LKDKIKAIYLEKKNSPSGSESYILMKMKIIGDDLIKLQVFIEKNSQRFTTKETIEIVKQR
LETLITKETDNNNKKILIHLVIESIGLSADEKASELFKYKKYLNLKDKKLESMIKKYLES
SRNLLNLYLFALTQDQCPKDLLTELEQKSWDHKTQDFLLIGNVKSYIMKEMIKMGRQNLS
EEYLKKCLLQFSGLAQLKSLLIKKYSNLIKKQYGQQTTEGVKYLLDQIKKASCLIEDKVY
DNLIQSLQLNSQIQVKKSSSQNDNQFEIYEMIYESKLHNGNNKDSQDVYLEYINFLVNVE
KNEQKALSLYNKAVKTIKSNQRDQFLQNYNAILSRR