Identifiers and Description

Gene Model Identifier

Contig17319.0.g84

Standard Name

UTP23

Aliases

Contig17319_0_g84

Description

Fcf1

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003105800.000000000008998169033602767hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17319.0.g84(coding)
ATGACAAAATGTGTTCTGAGAGAGTTCGAAATTTTAGGGCCATCTGTTGTAGGTGATACT
CTAAAAGAAGCAAAGAAAATTGTCAAGGAATCCTGTAAACATTCAGGTGGTATCTTGCCA
CCAGATGAATGCATAAAGAATTTTATTGGTAAAAAGAACGAGGCAAAGCACTTCGTTTGT
ACTAATGACGAGGAATTGAGAAATGAGTTGAGAAATTTAGGGACAGTTCCTATATTTTTC
TTTAAGAGAGATGGTATATTAGTTATGGACTCACCTACCGAAATTACTGAGGAAAAACAT
AGAATGAAAGAAATGCTGAAGAATGAACCTACGAGACAAGAGAAGCAATTTATTAAGGAT
TAATCAGAAGAAATTAAGGAATTCTTGAAAGAAGAGAAAGCAAAAGAAGCAAATAAAAGA
ATGCAATAAGTTAAAGAACTCTTTTGTATGGGTATCAAGACTAAATTAGCAAATGGACCA
AATCCACTATCAGTTCCAAGGAAGAAGAGAAGAGGAGGCGACGATGATGGCTCTGCTCTG
AAAAAGAGAAGAATAAGAAAGGGAAAGAGAAGCAAGGATCCAAATTCCTCAAAGAGATAA
AAACTTGATGGAGATGAAAATTTAGCAACCACAAATCAAGTATCAAGTGATTGA


>Contig17319.0.g84(protein)
MTKCVLREFEILGPSVVGDTLKEAKKIVKESCKHSGGILPPDECIKNFIGKKNEAKHFVC
TNDEELRNELRNLGTVPIFFFKRDGILVMDSPTEITEEKHRMKEMLKNEPTRQEKQFIKD
QSEEIKEFLKEEKAKEANKRMQQVKELFCMGIKTKLANGPNPLSVPRKKRRGGDDDGSAL
KKRRIRKGKRSKDPNSSKRQKLDGDENLATTNQVSSD