Identifiers and Description

Gene Model Identifier

Contig6655.0.g84

Standard Name

UTP21

Aliases

Contig6655_0_g84

Description

Utp21 specific WD40 associated putative domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam04192 ) Utp21 specific WD40 associated putative domain
  • ( pfam00400 ) WD domain, G-beta repeat
  • ( pfam07619 ) Protein of unknown function (DUF1581)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLR409C9.999565105288807e-71UTP21 SGDID:S000004401, Chr XI
I from 937233-934414, Gen...
T. thermophilaTTHERM_006470703.999244945363787e-60hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6655.0.g84(coding)
ATGATCGAGGACGCACAGATCTCAAATACAAATAGGAAATTGCACTAAAACATCTAAGAT
AAAGATAATGAAATCAATCATTCACTACTCTTTGAGCCTTACAGAGCATTTGGCTATTAC
ACCTCAGACATTCCATTTTGCATTTTCAAGAGTGATTAAGACATATTGCTTGCTACTAGT
GTAGGTGGACATGCATTTTACGTTTACAATACAACTAAACTGAATCTGGTTTACATGTCT
AGATTCATTGAGAATGAAATTATATGGATAGAAGCATCTCAAGATGGCTTCATATATACT
GCATTAGATGATAACTCAATAGTATCGTGGAAGAAAATGCATAAAACTAATTAATACATA
GGTCACACTAAACCTATCATAAAGTTCTTGTTAGCATCAGAGTTTATTTTCTCTTTGGCT
CAAGATGGTGAATTCATCATTTTCAACTTAAAGACAGGTTCAGTTATTAAGAAGCTTAAT
TATGCCCTCAAGTTTAATGTTATGATCCATCCAACGACATATGTCAACAAACTTCTCTTT
GCATCAGACAATAAAATTGAGCTCTGGAATGTGATTGATGACTAAAAGATTTATGAATTC
AAGAATATTACAGAAGGAAAAGAGCATTGCAAAATAACTCAAATAGTTTAAACTCCAGTA
GTTCACACTGCTGCTGTTGGATTCTCAGATGGAGAGATTAGATTAGTCAATCTACAATAC
GATTAAGTATTGTTTTCATTCCATTAAACTGATGGTGGAGTGTAAAGCCTTGCTTTCTCC
ACAGATACTACTCTTGGATTAAGTTTAATGGCCAGCTCAAGCAAGAACTCAGAAGGTGAT
TAGAGCATTGTATTTTGGGATTTGAACAGACAAAAGATTTACTCAATACTTTAGCTTCCA
CATAATGGAAGATAAATTTCTCACTTGCAATTCATAGCTAACGAACCAATATTAATTAGT
TCTTCAGAAGACGATAATTCATTGAAGATGTGGTTTTTTGAGAAGGGTCTCACTCAGCCA
AGATTATTGAAAGAGAGATGCGGACATGCCGAACCTCCTCATAAAATTAGATTCTATGGA
GGGAAAGATGATCCGGTCAATCAAGGAGCTAGAAATATAATATCTTGCTCTAAAGACGGT
CAACTAAGAGATATAAGCTTATTAAATGAATTCTAAAGCATGAACTTCTCAAAGAAAAAT
TTGACAAGATCAGAGCTCAATAGAGATTAAGGAGATGATGGCTTCGGAGCTGTAACTTAG
TTCGACTTTTGTGAATTCAGAGAAAGAGATTGGCAAAATGTTCTAACTTGTCAAGACAGA
AGCAAAGTACCATTCCTTTGGTCATATGCTAATCATTCCATCTCTAAAGTTCCTGTTGAG
AATATTTATCCTAAATTTAGAGTCTCAGCTGTAGCTAAGATCAATTTACAGAGTGGAAAA
GATAGAGGAACTTTTATCAATAAGCTTCAAGGATAAACTGTACATTCTCAATAAGTCACA
GGAGTTGGCATTGATGCTTTGAATAAAATAATGATTACAGCTTCTCTCGACTGTACCATT
AAATAATGGGATTTCTTTAGAAGAGAACTTATGCGCTCATTCTCAACTGAGTATCCAATT
GAAAATCTAGTCTACAACAGACTGAATGATCTTATTGCTTTTTCCTCAGCTGATATTTCA
ATTACTATTATGAACGTCAAGACTAATATCCTCAAAGTCAGAGAATTCAAAGAGGTAGCT
TCAAACAAAATAACTGATCTATGTTTCTCTCAACCAGACTCAAAATACATTATGTGCTCT
TCTCTAGATAAATCAATCAAGGTATGGGATATTCTTACGGGATAGCTTATTGATTGGATT
TAATTTAGAAATGCTCCACTCTCAATTGATTTTTCACCTTCTGGAGAGTTCCTTGCAACC
TCACATATCGGCTCAAAAGCAGTTTATTTATGGTCAAACAGACAGCACTTCCAAAATATA
ATAATCTCTGGATCTCCTAAACAACCAATTTAAATTGACTTGCCTACACTCTCTGAAACT
GAGAATGTAAAGAAGAGCCATAAAGATTTCTACAATGAAGATCAAAAGAATCTAACTAAT
CACATTGAAGAAAAGGGGTTAATTTAGCTAAAGTTTAAAGAGCTTGATGAAGAATTAAAG
TTAGTATAAAATCAGAGAAACTAGTATCTCTAGTTATCGAATCAACCATACTCAAAATGG
TAAGCTATTTACAACTTGGAATAAATTAAGGAGAGAAATAAGCCACTATTACCAAAGAAA
GAACTTCCAAAAGCTCCTTTCTTCCTTTTCGATTTAGATAAGGTGCTCGCCGATAATGAT
GCTACTCCAGATTTGCTTAAGGAGAAACTTTTCTCAAAACAAAACAAAGGGGATCAGACT
AGCTAAGCAAAGAAAGATTCAGAAAGCAGGAAATTAAAGTCTATACTAAACCAAAAGCCC
ATCAAGTGGAATGATGTAAATGATTTGTTCAAGAGCCTAAGTCCAAGTGGAATTGAATTA
GAAATCATTAGTCTGGCTACTTTCGATTTTGACAAGTCAGGTTCAAATCCTAATCAAAAT
CTTTCTTCTTTGATGGAATTCTTTATCCAACAACTCAGAGCAAAGAAGGACAGTGACTTT
ATTTAATCTCTTGTCAACTGTTTCATAAGAATTCATTATGATATTTTGATTGAAGACGAA
GATCTAATGAATAAAGTAAAGACAATAATGAATGAGAGTGAAAAGAATCATGATGAACTC
GAAAATCTAATTAATCACAACATTTGCATGATTTCTCATTTTGTTGATATTCAAATGCAT
TGA


>Contig6655.0.g84(protein)
MIEDAQISNTNRKLHQNIQDKDNEINHSLLFEPYRAFGYYTSDIPFCIFKSDQDILLATS
VGGHAFYVYNTTKLNLVYMSRFIENEIIWIEASQDGFIYTALDDNSIVSWKKMHKTNQYI
GHTKPIIKFLLASEFIFSLAQDGEFIIFNLKTGSVIKKLNYALKFNVMIHPTTYVNKLLF
ASDNKIELWNVIDDQKIYEFKNITEGKEHCKITQIVQTPVVHTAAVGFSDGEIRLVNLQY
DQVLFSFHQTDGGVQSLAFSTDTTLGLSLMASSSKNSEGDQSIVFWDLNRQKIYSILQLP
HNGRQISHLQFIANEPILISSSEDDNSLKMWFFEKGLTQPRLLKERCGHAEPPHKIRFYG
GKDDPVNQGARNIISCSKDGQLRDISLLNEFQSMNFSKKNLTRSELNRDQGDDGFGAVTQ
FDFCEFRERDWQNVLTCQDRSKVPFLWSYANHSISKVPVENIYPKFRVSAVAKINLQSGK
DRGTFINKLQGQTVHSQQVTGVGIDALNKIMITASLDCTIKQWDFFRRELMRSFSTEYPI
ENLVYNRLNDLIAFSSADISITIMNVKTNILKVREFKEVASNKITDLCFSQPDSKYIMCS
SLDKSIKVWDILTGQLIDWIQFRNAPLSIDFSPSGEFLATSHIGSKAVYLWSNRQHFQNI
IISGSPKQPIQIDLPTLSETENVKKSHKDFYNEDQKNLTNHIEEKGLIQLKFKELDEELK
LVQNQRNQYLQLSNQPYSKWQAIYNLEQIKERNKPLLPKKELPKAPFFLFDLDKVLADND
ATPDLLKEKLFSKQNKGDQTSQAKKDSESRKLKSILNQKPIKWNDVNDLFKSLSPSGIEL
EIISLATFDFDKSGSNPNQNLSSLMEFFIQQLRAKKDSDFIQSLVNCFIRIHYDILIEDE
DLMNKVKTIMNESEKNHDELENLINHNICMISHFVDIQMH