Identifiers and Description

Gene Model Identifier

Contig2665.0.g97

Standard Name

UTP18

Aliases

Contig2665_0_g97

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00400 ) WD domain, G-beta repeat
  • ( pfam02239 ) Cytochrome D1 heme domain
  • ( pfam08662 ) Eukaryotic translation initiation factor eIF2A
  • ( pfam07676 ) WD40-like Beta Propeller Repeat

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004259508.002927718340724e-80hypothetical protein
SGDYJL069C4.001118334825066e-42UTP18 SGDID:S000003605, Chr X
from 312706-310922, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2665.0.g97(coding)
ATGTTCGTAGAAAACAAGAAAAAGAGAGTTGAGAAACTTGAGGATAAGCAAGACTAATCC
TGGGCCAAGTAAGGAATCAAAAGTGACAATAGTACTTAACCTAAAATATTGATGCCTGCT
TGGACTGATAAGACCCTGGATAAATTAACTGTGAATATTGAAGACAAATCGAGACTTAGA
AAACTTAAGCAAACTGAAGCTGAGAAATCAATTAATGGAAATGAATATGCTGAGAGACTT
CAAGATTAATACGCAAAGATGATTGGAGGATCTGAATTATTTTCTTGGGCAGCACTTCCC
TAAGAAGATGGAAACATAGTTGGAGTTCAGGAGGAAGAAGATGAGGATCCAATCACTAAA
CTGCTAAAATCAAATGCTCATGTTTATAAGAAGAGAGACATGATCTTAAAATCAGAGAAA
ATCAGCTTCTCAAGACTTCTACCTGCTAACAATGGGCACTATCACGAATCTGTTGTTACA
GCTATGCATTTTCACCCAACAGAAAACATTTTATTGACTTGTGGACTTGATAGAAAAGCA
AAACTTTTTAACGTTAACAGTAAAAAGTCTACTAAAATCTAATCAATTTTCTTCCCTGAT
TTGCCAATTTACAACGCAGCTTTCATATTGAATGGCTAATAGATAATTTTCTCTGGAAAT
AGAAAGCACTTCTATTATTACGATATGCCCTAAAATAAAATCGAAAAAGTTTCACATATC
ATGGGACACAGTGATGAGACAAATCTCAGCAGATTATTTGTTTCCTAAGCTTAAGATTCA
GATTATTTTGCCTTCGCATGCCAAGAAAGTGGCTATATTCTCATCATGAGCCAAAAGACA
AAGAAGTTAATGTTTGAGTTTAAAATGAATGGCAGCTGTAACGCACTATGTTTCAGTCCA
GATGACAGATATTTGTTCAGTGTAGGGGATCAAGCTGAAATTTATCAATGGGATTTACAG
TAAAAGAAATGTGTAGCTAAGTATGCTGATGAGGGAAGTTTCAACACCACACATATTACT
ATGAGTCCAGACGGCAAGCTACTGGCCACAGGATCATACATTGGAGTAATCAATATCTAT
AAATTTGATTCTACAAATACTCAAAGAGTTGAGGGATCAGCTCCCTTGAAATCAATCATG
AATTTGACAACTGCAATCACTGACCTTAAATTCAATCCAACTAGCTAGATACTTGCAGTT
TGCTCTAAGTGGAAGAAAAACGCAATAAAATTGATTCATATCCCATCCTACACAGTATTC
CAGAATTTCCCTGGTGTTGCAATCGGTGTCTTAAAATACGCACTATGTTTGGATTTCAGT
TACTCAAGTGAGTTCATGGCACTTGGCAACGATGAGGGCAAAGCACATCTATTTCATTTT
AGCCATTTCTCAGAAAACCAGAATTGA


>Contig2665.0.g97(protein)
MFVENKKKRVEKLEDKQDQSWAKQGIKSDNSTQPKILMPAWTDKTLDKLTVNIEDKSRLR
KLKQTEAEKSINGNEYAERLQDQYAKMIGGSELFSWAALPQEDGNIVGVQEEEDEDPITK
LLKSNAHVYKKRDMILKSEKISFSRLLPANNGHYHESVVTAMHFHPTENILLTCGLDRKA
KLFNVNSKKSTKIQSIFFPDLPIYNAAFILNGQQIIFSGNRKHFYYYDMPQNKIEKVSHI
MGHSDETNLSRLFVSQAQDSDYFAFACQESGYILIMSQKTKKLMFEFKMNGSCNALCFSP
DDRYLFSVGDQAEIYQWDLQQKKCVAKYADEGSFNTTHITMSPDGKLLATGSYIGVINIY
KFDSTNTQRVEGSAPLKSIMNLTTAITDLKFNPTSQILAVCSKWKKNAIKLIHIPSYTVF
QNFPGVAIGVLKYALCLDFSYSSEFMALGNDEGKAHLFHFSHFSENQN