Identifiers and Description

Gene Model Identifier

Contig16608.0.g41

Standard Name

UTP14

Aliases

Contig16608_0_g41

Description

Utp14 protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006378004.9988726541653934e-26hypothetical protein
SGDYML093W0.00000000000007997998332353294UTP14 SGDID:S000004558, Chr XI
II from 83090-85789, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16608.0.g41(coding)
ATGGGAAAGAAACAAAGAGCAAACAGTGGTCTGAGTTCAGACAAAAAGCAACACATTCAA
TAAGACGAAGACCTCCACTTTAAGATGCTGGAGTAGTTAGGACTCTCAAAGGAGGAAGGT
ATGAGTTTAATGAAAGACATTAAGAAAAAGACATCAAATTAACATAAAAAGGGAAGTAAA
GATCAGAAAATGAGAGAAGAGTAGTAGATGCAGCAAGTAGTAGACGATGCAGATTTATTC
GCAGGGGATGATGGCGATGACTAGCAACTCACACTTGGAGATATTTTCTAATCCATTGGT
GCTAATAAAATGCAGGAGCAGACTTCAAGTGGCAAAAAAGGGAAAGTTTCAGAGACGATT
AACGCAACTAAGTTGGAGAAGCAGATCAAAGAATTAAGGAAGGAGGCTGAGAGAAACCCT
GCACTTTCCTAACCACTTACTGGTAGGAAGCGATTGTAGATTGAAAGAGATGAGAACTAT
AAGCAAGTGCAGAAACACATGACTAAGTGGCTGCCACAGGTTAAGTAAAACAGAGAAACT
GAATAGATGGACTTTACAACCAGAGATGTTATCGGAGAAGGCGGCGGAGTAAAGTTGAAC
TCCATGAATTAAATAGCATCTAACTTGAAAGCATCTCAAGCCACCTCTTAATTAGAACAA
TAAATCTAACAAGAATTGACTAGACAGGGTCTCCATTCAGAGAATGACATTAAAAAGAAA
GAATAAGATCAACTCATCAATCGTTTAGATGCTGACCAATTAGAGCAGAGATATCAGCAA
ATTTCTTAAATGAAATCCCTACTTTTCCGCTAGGAAATGAAAAACAGAAGAATCTCAAAG
ATCAAGTCAAAACTCTATCACAAGATTAAGAAGAGAGAAAAGGATAGAGAAGAGAAGAAA
CTTATCGATTATTTGGAATAGATAGATCCAGAAGCTGCATAAGCCTATAGAGAAAAGGAA
GAACAGAAAAAGGTGGAGGAAAGACTGAAGCAAAGACATTCAAGCAATAATAAATTCGCA
AAGAAACTCAAGCGTTTTGGCATGATGGAAAACGAATCAATCAGAGAGACTTACAATGAA
ATGATGAGAGAGAAGAATCACCTCAAGTTGAGAACTAAGAAAGTTGCCACAGGAGTCAAT
GGAAAAGACAATTCTGAATCTTAGTACTCTAGCGATGAAGATGACTCGATGGAAGAAGAC
TTTGATGAAGAGGCTCTAAAGAGGAAAGCATTAGCTGCCATTGAAGATGAAATAGAAGAT
GATTCTGATGAAGATGACTCAGACAATGCAGGAAGTGATAGTGATGAAGACTTAGCTATG
AACTTCGCTAGTAACAAGAAATCAGAGAAGAAACCATCCAAGAAAGAGGATAAAGGTATC
ATGGGCTTGAAATTCATGAAGAGAGGAGAAGAGAGACAGAAAGAAATGACCAAGCAGCAA
GCAAAAATGCTCATGGATCAAATCAGAGAAGACCAAGAAATCTTAGATCAATCAGACAAT
GACAACTAAGCAGAGAAGTAGAATTTCTTTAAGGGAGCAGCCAATAAATTTGCAGCTAAA
ACCCTTTAAGTCAAGGAGCTCGAAGTTGTTCCACTCACTGATGAGCAAATTAAGAAAGCC
ACTCAAAAATTAGTTGTTAGATAGGCTGAAAGCGAAGAGGATGATTCATCAGAGGAAGAG
CAAAGTCAACATAAAGCCAAGAAAGAAGAGAGTAAGATTGGTAAGAAGCAAGGAAATAAG
AAAAATTCAAAGAAAGCTGAGAAGCTAGAAGTTACTTTTGATATCAACGAAGACTTGAAG
AATTTTAAGCCAGAATCCAAGAAAGTCATATCAATCGCTAAAGACGATCAAGTGCTGAGA
AATTTGTTTATTACACCATAAGATGAAGAGCAAGCAATGGAAGACTTTGAAAGAGAGAAA
GATTAAGATATTGAGGATGAACTTGGCAATAAAGTTAAAGCACCAGTGGTCTAGAGAGGC
TGGAATGAATGGGCTGGTGATGGAGTATCTGAGAAAAGTCACGATAAAAAGGTTGCAAGA
GTGTAAGAATTCAAGAAGAAGAAAATTGAAGAGCTAAAGAAGCAAAGAGCTGACAGCAAA
ATTAAAGGTGTCGTCTTAAACATTGAGGAACGTGATAAGAAATTTGCTTAGAAGTATTTG
GTTAAGGAACTCCCACATCCTTATAACAACGTTAAACAATTCGAGGCTTTGATGAGTGTG
CCACTTGGAAAAGACTGGAACACAATTCAATCTCATAAGCGTTTAATTCAACCAGATGTG
CTCACAAAAGCTGGTACAATTATTAAACCACTTAAATATAAGAAAGACATTCCAATGAAA
GCAGAAACTTTAGAGGCACTAGTCGAACATAGACAAGGCAAGAAGGAAAAGAGACCTGCA
GCTAAGTTTTGA


>Contig16608.0.g41(protein)
MGKKQRANSGLSSDKKQHIQQDEDLHFKMLEQLGLSKEEGMSLMKDIKKKTSNQHKKGSK
DQKMREEQQMQQVVDDADLFAGDDGDDQQLTLGDIFQSIGANKMQEQTSSGKKGKVSETI
NATKLEKQIKELRKEAERNPALSQPLTGRKRLQIERDENYKQVQKHMTKWLPQVKQNRET
EQMDFTTRDVIGEGGGVKLNSMNQIASNLKASQATSQLEQQIQQELTRQGLHSENDIKKK
EQDQLINRLDADQLEQRYQQISQMKSLLFRQEMKNRRISKIKSKLYHKIKKREKDREEKK
LIDYLEQIDPEAAQAYREKEEQKKVEERLKQRHSSNNKFAKKLKRFGMMENESIRETYNE
MMREKNHLKLRTKKVATGVNGKDNSESQYSSDEDDSMEEDFDEEALKRKALAAIEDEIED
DSDEDDSDNAGSDSDEDLAMNFASNKKSEKKPSKKEDKGIMGLKFMKRGEERQKEMTKQQ
AKMLMDQIREDQEILDQSDNDNQAEKQNFFKGAANKFAAKTLQVKELEVVPLTDEQIKKA
TQKLVVRQAESEEDDSSEEEQSQHKAKKEESKIGKKQGNKKNSKKAEKLEVTFDINEDLK
NFKPESKKVISIAKDDQVLRNLFITPQDEEQAMEDFEREKDQDIEDELGNKVKAPVVQRG
WNEWAGDGVSEKSHDKKVARVQEFKKKKIEELKKQRADSKIKGVVLNIEERDKKFAQKYL
VKELPHPYNNVKQFEALMSVPLGKDWNTIQSHKRLIQPDVLTKAGTIIKPLKYKKDIPMK
AETLEALVEHRQGKKEKRPAAKF