Identifiers and Description

Gene Model Identifier

Contig18453.0.g8

Standard Name

UTP13

Aliases

Contig18453_0_g8

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00400 ) WD domain, G-beta repeat
  • ( pfam08625 ) Utp13 specific WD40 associated domain
  • ( pfam11715 ) Nucleoporin Nup120/160
  • ( pfam12742 ) Gryzun, putative Golgi trafficking
  • ( pfam02565 ) Recombination protein O C terminal

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000467702.0007666164339447e-112hypothetical protein
SGDYLR222C8.000204209547377e-76UTP13 SGDID:S000004212, Chr XI
I from 581771-579318, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18453.0.g8(coding)
ATGGAAGACGACAGCAATATATTAGAGTTGCAAGATCAAATCAGATTGACTAAGCACTAC
GATTTGTTCAGAGATTTCCAACCACTATATACAGGTGGAGCCTTCTAATTGATGAAAGAT
GAGCAGCACTGCATATCATTAAGAGATGGAAAGATTTGTCTCTTCAATATTGAAACATCT
AAAGTCCTTGCATCTTTCTCTCAGGAAAATGAGGAACTCTTAACTTTCACTCTATCTCCC
AATCAATAGCTTCTCGCAGTTTCAAATAAGAATTACTTAATTAGGGTTTATCAAATCCCT
GAAGATATTTCTAGTTTCAGCTAATTAGAAGAGGTTAAGATGTTTAAGACAACTGGGTAA
ATGGTATTAGAATTAAGTTTTGACCCATCTAGTAAATTCCTAGCAGCAGGTACTGCAGAT
AGTGCCGTGAAAGTATTCGATGTTAAAAAAGGATTCCAAACTCACAACTTAATAGGACAC
AGAGGTATTATCACAAATCTGATATTCTATCCAGAATTAGATTCACTAAAACTTATTTCC
ACGGCGGAGGATATGACTATTAAAGTTTGGGATTTAGTGTTAAGATAGGAGATACATAAT
CTAAGATTCCATTAGGCATTAATTACCAATTTAGTGTTTTCACAAGATAAAAATACTCTT
GTTGCTTCATCTAAAGATGGTAAAGTCTCATTTTGGAATGTTAAAGATAACTACAAGCTA
TTATCTTCTATCAAATGCAATTAAGATGAAAACCCAGATGAAATAGAAGAATTAAATGCA
GTTTATATGTTTAATTCAAACACTGAACCATACCTTTTAATTGGTGGCCAAACAGGAACT
CTTAAAATTTTTGACATAAAAACCTAGAAATTTTGCTTCGGTCTTTTAGATAACTGTCTT
AATTCTGAAATTACAAAAATCATTCCAGCCTCAAATAACTAAATCTTTGTTCTTAATGCT
GATCAAAACTTGAATGTTTACAAAATTATCAATAAAACTAATAAGAAAACTGGATAACAA
AAGCCAAGTCTCGCTTTAAGTTTATCAAAGTGTTTGTACTTGGATGAAATTATTGATCTA
AAAATAATCAAGAAAGAAAGTGAGGAAACTTTAAAACCTGTACAAGCAGTTATATGCTCA
AATAATGAGACTGTTAAGCTTATGGATCTTGAAACAGGGCAAATTAAGTAATTTGGTGGT
CACTCAGATATTATCTTATGCTTAGATGTAAACAAAAACATGATCATTTCTGGATCAAAA
GATAACCAAATTAGACTGTGGTAAGTTAGTGAGTAAAGTAGTGATCTCAATTGTTTGGCA
GTTTTCTAAGGACACACTGAAAATATTGCTTCTATTTTCTTTGCTCCTAAAAAATGCAAT
TTCTTTGTCTCAGCGAGTTAAGACAACACGATTAAAGTTTGGGATCTTACATCCTTCAAG
GGCAAGGATGAAATTTCAGATGAAGTAGAAGAAGTCACCTCTGCAAACTTGACAATAGTT
GGTCATTAAAAATACATAAATGTTGTCAGAGTTAGTCCTAATGATAAACTTATTGCTTCT
TCAAGTTAAGATAAATCAATCAAAATTTGGAATGCTTCAAACTTAATGCTAAATCATACA
TTGACAGGTCATAAGAAAGGAGTCTGGGATGTTGCCTTCTCACCAGTTGACAAAATTTTA
GTTTCAGCTTCTGGAGATAAGACTCTCAAGGTTTGGAATTTGTAAAATGGAACTTGCATT
TCCACTTTCTAAGGCCATTAAAATTCTCTTGTTAAAATTGGATGGCTAAATCTTGGCATG
CAAATCATATCCTCATCAGTTGATGGCGTGGTGAAAATTTGGAACTTGAAGAAATAAGTA
TGTGTTAATACAATGCAAATGCATGATGAAAAAATTTGGGCTATGGAAGCAAATGATAAG
TTTATGGTCACAGGAGGAGGCGACTCATCTGTGAAAATTTGGAGGGACTGCACATTAGAG
AAAGAAGTTGAAGAAAAGGAAAAGAATCTACAGAGACTTCAAGATGAATAAAAGCTTTCA
AACTTAATTAGAGATGAAGATTATTCAGAAGCAGCAATGATGGCTTTTAAGCTTAACAAG
CTAAGAGATTTCTATCACGTATTAACTAAGGTAATAAGTAAAGGAGGCGCTGGGAAAATG
GACTTAGTTGATTCAGTACTAGCTGATAGAAAACAAATGAGCTTATCTTTAGAATAAGAA
TTCAAGCAGGCATCCTAGGAAGTAAAGGGTGAGCAACTACTCACTAAAATCTTGACAAAT
CTAGTAAAGGAAGACAAAAAGAGGCTTTTAGAGATCATTAGAAATTTGAATTCAAAGTCT
CAATATGCATCTCTCGCTCAACATATACTTTACACTATTTTACCAAGATTCAAGACTGAC
GAATATGTGGAAGAATTCAAAGCAAACTAAAATGAACTTAAAGACCTGCTTAAAATTTTG
GAATTTTACAGTCAAAAGCATCTAGAAAGATCAGAGAGAGGATTAAAGAAAGCTTTCTAT
CCTACCTACGTCTTATCTCAAATGACATTACAAGATGACATCTTGCTTGAATAGTAAAAA
TCAGAACAAAAGATAAGCATTAATGATAGTGATATAACTCTACAAATCAGGAAGAACAGT
GAGAACTCCTTGGTAAAGAACAAAAAAGACACGAAACAACTTTAAACTTAACTCTTAAAT
CAAAAGAAAAAGAGAAAGTAAAAAGAAAGAGGAATTAATGACAACCTTTTCTTGGACAGT
GATGCTTCAAAATAAGACAACCTCTCTAAAAAGCATAATTTAACCAAAAGAATGAAGGTT
TGA


>Contig18453.0.g8(protein)
MEDDSNILELQDQIRLTKHYDLFRDFQPLYTGGAFQLMKDEQHCISLRDGKICLFNIETS
KVLASFSQENEELLTFTLSPNQQLLAVSNKNYLIRVYQIPEDISSFSQLEEVKMFKTTGQ
MVLELSFDPSSKFLAAGTADSAVKVFDVKKGFQTHNLIGHRGIITNLIFYPELDSLKLIS
TAEDMTIKVWDLVLRQEIHNLRFHQALITNLVFSQDKNTLVASSKDGKVSFWNVKDNYKL
LSSIKCNQDENPDEIEELNAVYMFNSNTEPYLLIGGQTGTLKIFDIKTQKFCFGLLDNCL
NSEITKIIPASNNQIFVLNADQNLNVYKIINKTNKKTGQQKPSLALSLSKCLYLDEIIDL
KIIKKESEETLKPVQAVICSNNETVKLMDLETGQIKQFGGHSDIILCLDVNKNMIISGSK
DNQIRLWQVSEQSSDLNCLAVFQGHTENIASIFFAPKKCNFFVSASQDNTIKVWDLTSFK
GKDEISDEVEEVTSANLTIVGHQKYINVVRVSPNDKLIASSSQDKSIKIWNASNLMLNHT
LTGHKKGVWDVAFSPVDKILVSASGDKTLKVWNLQNGTCISTFQGHQNSLVKIGWLNLGM
QIISSSVDGVVKIWNLKKQVCVNTMQMHDEKIWAMEANDKFMVTGGGDSSVKIWRDCTLE
KEVEEKEKNLQRLQDEQKLSNLIRDEDYSEAAMMAFKLNKLRDFYHVLTKVISKGGAGKM
DLVDSVLADRKQMSLSLEQEFKQASQEVKGEQLLTKILTNLVKEDKKRLLEIIRNLNSKS
QYASLAQHILYTILPRFKTDEYVEEFKANQNELKDLLKILEFYSQKHLERSERGLKKAFY
PTYVLSQMTLQDDILLEQQKSEQKISINDSDITLQIRKNSENSLVKNKKDTKQLQTQLLN
QKKKRKQKERGINDNLFLDSDASKQDNLSKKHNLTKRMKV