Identifiers and Description

Gene Model Identifier

Contig17879.0.g65

Standard Name

UTP11

Aliases

Contig17879_0_g65

Description

Utp11 protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003162406.000675497867615e-22Utp11 protein
SGDYKL099C3.998609120989657e-17UTP11 SGDID:S000001582, Chr XI
from 256472-255720, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17879.0.g65(coding)
ATGTCCACTGCAGCATCATGGCGTAATGCTATCCCTAGACGCATGTACAGAGAGCGTCGT
CAGTTGAAATCCAGAGAACATTTGGGTTTGTTGGAGAAGAAGAGAGATTACAAGAGAAGA
GCAAAGGACTTCCACTCCAAGTAAAATGTCATCAAAAAACTTGCCGAGAAAGCCCTACAA
AGAAATCCAGATGAATTCTATCATAAAATGGTTAACACTTAGGTTAAGGATGGAGAACTG
TAAATCCTCTCAAAAGACAACAAAGACACACAAAAACGCAGAAAATTGGACGAGTAGAAG
GACATAACTTTAGTAAATTTGAGAAGAATGGTTGAGAAAAACAAGGCAGAAAAGATCCAG
AATAACCTGCATATGATTGACTTCCCCAAGCAAAATCAGCATATTTTCTTCGTGGCTGAT
AAAAATTAAATCAAAAATGAGGGGAAATCTAAATAAGTAGACGACTTATTTGAATAGGAG
AGATAGAAATAACAATAATAATAAGATGGATTCAGCTTCGATGACTAAGAAGATGGAGAT
GAGATTCTCAGATTTGGAGAGGACAATGTCAAACCCCAAAAAGACACTCAGCCAAGACAA
AAGTATCAAAGCGAGAAGGAAAAATACATGCTCCAATTAAAGATAAACTAAGCAGTGAAC
AAGCAGCAGTACAAAAAGCTCGCTGATTCGATGGTCAAGGAGCAGCAATTCAGTAGAGTG
CAGGAAGCGCTGATTCTTGATAAACATATCAAGGACAAAGGCAAGAAGAGAAAGGTAGAG
GACAAGGACACTGGCAGGACTCACTTCAAGTGGTTCAGTGAGAGAAAGCGATGA


>Contig17879.0.g65(protein)
MSTAASWRNAIPRRMYRERRQLKSREHLGLLEKKRDYKRRAKDFHSKQNVIKKLAEKALQ
RNPDEFYHKMVNTQVKDGELQILSKDNKDTQKRRKLDEQKDITLVNLRRMVEKNKAEKIQ
NNLHMIDFPKQNQHIFFVADKNQIKNEGKSKQVDDLFEQERQKQQQQQDGFSFDDQEDGD
EILRFGEDNVKPQKDTQPRQKYQSEKEKYMLQLKINQAVNKQQYKKLADSMVKEQQFSRV
QEALILDKHIKDKGKKRKVEDKDTGRTHFKWFSERKR