Identifiers and Description

Gene Model Identifier

Contig22006.0.g86

Standard Name

UPF2

Aliases

Contig22006_0_g86

Description

MIF4G domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004427603.001416859614811e-48MIF4G domain containing protei
n

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22006.0.g86(coding)
ATGAACAATAACAAGGAAATCCTGGATCGATCCACCAAGAAATTCTTGATGGAAGATATG
CAAGAATAGTAAGATAAAATGCTTGAAGAAAGAGATATTAATTTAGTACTTTTAACATAA
GATTACAGAGATTCTTTACCAAGAACTCTCTGTAGCAAGCTAGATAGAATCCAGAAATTT
ATAAACTAATTAAAATCTGCCTAAGATAGCAAAAGATTAATGTTAATTGAGGAATGCCAA
GAATTAAATCTCAAGAGGCACACCTCAGAGGTAGTAGCAAGCATCACCTCAAGCAAAATG
ACTATTAAAGATCAAGATACAATTATAGAGATTTGCGTGTTAATGCACCACAGATATGAA
GAATTCGCCTAGAAATTAATAGATGCGCTTGAGAGACAGTTTTTCCAAGAAAAAATGAGC
GAATTTAACAAGAAAAGAAATATTCTTAGACTTTTGTCAGAATTATACCTCAAGGGACTT
TTCTCTGAGTTTAAGCGATTGTTTAAGGGCATTAGCTATTTAACATAAATCACACCTGAT
AAAGAGGAGTTTCAGAGTGCTTTAATGGTATTGACTGATTACCTCAGAAATTATGGAGAG
ATGTTCTTTCATTAGCTTAGTAAGCAAAGGAGAGAAGCTATTGATAACGATTATGAAGTC
ACTATAGAAAGACCTGATTTCTTGAATAAGCAGTAAAGAGAGAAAATTCATTAGTTTTTT
AAAGATTATTTGAATCAGAAATGCTTAGAGGAAATCAATAATAGATATAAACTTCTTAAG
GATGCAAAGAGAAGATTTGAAGATAATTTAAAGGAGGTGAAGCAAGATGAGAAGATAGAA
AATTCATACATGACAATCAGAAATGAATTTGAAAAAATGCACAATATAGTTGAAGAATTT
GCAGATACTATTGACAGCCCAATTCCTGAATTCATCATCGAGGAAGATAAATCTCTATAG
ACTAAAATGATATTGAAGAAGAAGTAGAAGGTAGATGCTAGTGACGAATTTTTCCCATTT
GAGGATGAATTAACTCATAACTTTTACAGAAATTTCCCTGATCTTAGCAGATTCATATAA
TCTGAAAAAGAAACTACAGGTTTATCATAGCTTAGCATGACTTCCTCTGAAGCCGATCTT
GATGAAATGCACAAGAAACTTTAAAAAAGTTAAACTAAGGATTAAATCGATGAAAAAGCA
CAAGATTTTATTAAGTAAAATCCTTGTGTCTAATTCAAATCTGGCCGCAAAGAAATGGCT
AAAATTTTATTCAATATTCCTAGAAATTCCCTATCTTTACTACCTTACTATGCTAGGTTC
ACAGCAATTATACATTACTATTTCAAAGATATGGGAAATGATCTAATAAAAATGCTTGAA
CATGAATTTAATGAGCTCTATGAACAAAATGATGTGATTAAAATTGAAACTAAAATTAGA
AATATCAGGTTTTTGGGAGAGTTAACAAAGTTTTAAGTTTGCCCTCCTTAAACTATATTG
GAGTGTCTAAAGAAATGCTTAGATGACTTTCATGGACATAATGTGGAAATTATCACAAAT
TTGTTAGAGACATGTGGGAAATACTTATCAAAGCTTGAGGAGACATAGCTAAAGTTTAAT
AACCTTATTGAGTTTCTACAAAGACTTAAAGAAAAGGAAAATATAAGCAGTAAATAACTA
GCTAATCTTGAAAGTGCTTTACTATAGTGCAGAGGACCCGTAGGAATAAAGGTTCATCCC
AAAAAGCAAGAATTGTTAACAAATATTTAATTCTACATCAAGCACTTATTTTTGGAGAGA
ATCAGCAAGAAGACTCTTGATGAAGTGTTTGTGCTAATCCTTAAATTACCATGGCATGAT
GAAGAAGAATTCATAAGCAGGATGGATACCATTGCAATTTTATTAGCAAGCTTGAAGCAA
TACTACAGACCATTTGTTGTAAAAGTGATAGACTCTATATTTGAGGAAATTCTCAGATAA
TGTGAAAGAAATGATTTTAAAGAATCTCAAAGGAGAGTAGCTATGATGAAGTTTATTGGA
GAATGTTACAACTTTAAGGTACTTCATACGCAAGTACTCTTTGATTTGCTCTACAAACTT
ATGAACTACGATAACCTCACATAATAAGAAGATGAAATTATGAAGTCACTTGACTCACCC
TAAGAGTCATTTAGAATAAGATTGATTTGCACTACCTTAGATTCCCTTGGTAGATTCTTC
TAAAGAGGTGAACGTAGAAGAATCATGGATAGATTCTTGATGTTTTTCTAGAGATACATT
TACTCAAAGAATTATGTGCTCATGGATTTAGAGTTCATGATTCTTGATACTTTTGACTCT
GTAAGACCAAAATTTATAAGATTTGAAAGTCAGGAAGAAGCAATTTCTGTTTGCAAAAAG
ATTGAAGATTATGAAGAGAGAGGAGTGGATATAATCGATATAATTAAGGCTTATCACGAA
GATACAGAGCATGAGCAGTACATGAACGACTACTATGAAGAGTACTACGATGAAGATTAT
GGCGATGAATAGCAAGACGATGAGGAAAACTTCAATGATGATAATTAAAATTAAGCAGAG
AAAGACGATTTAGATGATAAAATCAAGGAATAAATCAAAGAGTAGAGATAACAGATGCTA
AATGAACAAGAGAAAATGGAGATGCAAGCGTTCGAAGCAGACTTCAATTAACTCATTCAA
GAAAGTGCTCAAGTAGCCAGAAAAGAAATTGGCAATATTTTAACTCAGTAGAGGAAAGAA
ATTTTGATCCCATTTGCTTAAATCAAAAGCAAATTGGCAAATAGCTAGACTTAACAACAC
TCAAATGCGTCTACTAACTTAACTTCCACAAATTCCTCAACGTCATACAATGACTCTAAA
AATAACTCAGCTGGCTAAAAGCAACCTATAAACTTAAATAGTATGGCATTTGCTTTAGTG
ACTAAGAAGGGCAATAAAACTAATGTAAAGCAAATAGATGTGCCTTTAAATTCCTATATT
GCTGTCAAGACCAAAGAGAGAATTCTGGCTGAGGAAGAAGAGCGTGAAAAAGTTAAGGAG
CAGATTTTAAAGATCACTGCTCAAGATTAGGACAAATTGAGTCAAGAAGATGAAGATGAC
GATCTCGACCATAATGAAGATTATGATGAAGAAATTAATTGA


>Contig22006.0.g86(protein)
MNNNKEILDRSTKKFLMEDMQEQQDKMLEERDINLVLLTQDYRDSLPRTLCSKLDRIQKF
INQLKSAQDSKRLMLIEECQELNLKRHTSEVVASITSSKMTIKDQDTIIEICVLMHHRYE
EFAQKLIDALERQFFQEKMSEFNKKRNILRLLSELYLKGLFSEFKRLFKGISYLTQITPD
KEEFQSALMVLTDYLRNYGEMFFHQLSKQRREAIDNDYEVTIERPDFLNKQQREKIHQFF
KDYLNQKCLEEINNRYKLLKDAKRRFEDNLKEVKQDEKIENSYMTIRNEFEKMHNIVEEF
ADTIDSPIPEFIIEEDKSLQTKMILKKKQKVDASDEFFPFEDELTHNFYRNFPDLSRFIQ
SEKETTGLSQLSMTSSEADLDEMHKKLQKSQTKDQIDEKAQDFIKQNPCVQFKSGRKEMA
KILFNIPRNSLSLLPYYARFTAIIHYYFKDMGNDLIKMLEHEFNELYEQNDVIKIETKIR
NIRFLGELTKFQVCPPQTILECLKKCLDDFHGHNVEIITNLLETCGKYLSKLEETQLKFN
NLIEFLQRLKEKENISSKQLANLESALLQCRGPVGIKVHPKKQELLTNIQFYIKHLFLER
ISKKTLDEVFVLILKLPWHDEEEFISRMDTIAILLASLKQYYRPFVVKVIDSIFEEILRQ
CERNDFKESQRRVAMMKFIGECYNFKVLHTQVLFDLLYKLMNYDNLTQQEDEIMKSLDSP
QESFRIRLICTTLDSLGRFFQRGERRRIMDRFLMFFQRYIYSKNYVLMDLEFMILDTFDS
VRPKFIRFESQEEAISVCKKIEDYEERGVDIIDIIKAYHEDTEHEQYMNDYYEEYYDEDY
GDEQQDDEENFNDDNQNQAEKDDLDDKIKEQIKEQRQQMLNEQEKMEMQAFEADFNQLIQ
ESAQVARKEIGNILTQQRKEILIPFAQIKSKLANSQTQQHSNASTNLTSTNSSTSYNDSK
NNSAGQKQPINLNSMAFALVTKKGNKTNVKQIDVPLNSYIAVKTKERILAEEEEREKVKE
QILKITAQDQDKLSQEDEDDDLDHNEDYDEEIN