Identifiers and Description

Gene Model Identifier

Contig17825.0.g106

Standard Name

UPF1

Aliases

Contig17825_0_g106

Description

RNA helicase (UPF2 interacting domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007263009.997093137033517e-262phage head-tail adaptor, putat
ive family protein
SGDYMR080C9.997093137033517e-262NAM7 SGDID:S000004685, Chr XII
I from 429627-426712, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17825.0.g106(coding)
ATGCAATCATATTAAGGAGCTAGACCGACCTTCATGAATAGTGGCTAACCCAAGAAAAAT
ACAGATAGTAATAATGCTAATTTGTAAAAATAGCAATAAAACCAAGCTTAAAACTAACCA
AACCCTAATAAGAGCAACTACAGATACGATAAGGAAGAAGAAAAAGTAGAGAATTGGAGA
AATATGGGTGGATCAGGCACTAATAATGCCTAAACTAGCGATAGAAGTGGATCAAGCAAT
GATGCCACTAGTAATATTTATGTGAGTGGTGTAAGTGGTGCTACCTAAGTCTCAACCTCA
GTCAATCAGACGAACTAGAAAGGTGGGGTAGGTGCTAGTGATTTCGGCAATAAAAATGGC
TATAACAACAACTCAGCTCAGAAGAAGCAAGGAGGAGCTTCGAGTTTTGATGTGTTTTCT
GGTAAAAAGGGGGCAGCTTTTCAAAGCGACGACAGCAGCAGTAGCAGCGAAGAGGAGGAG
GAAGATTTTGGGGATGACGATGGACGCATGAGACGCATGGATGACTTGAATAATAGCAGT
TCACACTTCGATGCGAGGTCTGAAATCTCTGAGTCAGTAGGCAGTGTGGACCTAGAAGCA
GTCGAACCTTATGACTTCAATAATTTACCACAACATGCTTGTGCATATTGTGGAATACAT
GAACCAGAGTGTGTGGTTAAATGCTCAATTAAAGAGTGCAATAGATGGTTCTGTAACGGC
AAGGGTATTAACGAGTATGGAAGTCACATAATGCTTCATTAGGTGAAGTCTAGACACAAA
GAAATCTCTCTCCATCCCGATTCCCCTCTCAAAGACACAGTAATTGAATGCTACAATTGT
TCAAGCAAGAACATTTTCCTACTAGGTTTCGTCTCCGCAAAACAAGAAGCAGTCATTATT
CTTCTCTGCAGAGAGCCCTGTCTCAGTCAACTTTCCGTCAAGGACAGCAAGTGGGATATG
GAAAACTGGCAGGCATTAATCGAGAACAAAGCCATATTGAGTTGGTTAGTCAAGTTTCCA
TCAGATTTTGAGTTCAAACGCTCAAGGAAAATTACTGCTTCGTAGATCAACAAACTTGAA
GAGCTCTGGAAAGAGAAGCCAACTGCCTAAGTAGGGGATTTGAATGTCATTTAATAGGAG
AAAGCAATGCAACCAGTCTTATTGAGATACAAAGACCCCAAGCAGTACAAGGATATATTC
GAACCCTTGATTAAACTGGAGGCTGACTACGATAAAAGCTTCAAGGAATCGCAAACTCAG
AGAAATATCAGAGTCAGATTTGACTACAGCTTAAACAAGAAGAAGCAAGCATTTTTCATA
TTCCCAAATGAAGATAACATCAGACTAGTCCCTGGAGATGAACTGAAGCTAGTTTATGAG
TATGAAGGACAGCCTAAATGGCAGAGTAGAGGTCACATCGTAAGAATAGTGAATGAAGAG
ATATGTCTTGAATTGAAAAATCCAAAGGGATGCCCCAATGATCCTGACATCAGATTTACA
ATTGAGTTTATTTGGAAATCAACTTCTTTTGATAGAATGAGATTAGCTTTGAAGATATTT
ATGAGAGATGAGCAGTCACTTTCAAACTACATTTTCTACAAGTTGCTTGGTTATAACACA
CAAGAGCAGTTCATAAAGACCAACATCCCAAAGCATCTATCAGTGCCTGGCTTGCCAGAA
TTAAATCACTTCCAAATGAATGCAGTTAAGAAGGCTTTAATCACACCACTATGTTTGATT
CAAGGGCCTCCAGGGACTGGTAAAACAGTCACTTCGACGACATTAGTTACACATTTAGTT
AAGCAGAAGATGGGGAAAGTCTTAGTGTGTGCTCCATCAAATATTGCTGTAGACTAATTG
ACAGATAAAATTAATAGTACTGGTATTAAAGTAGTCAGAATGTGTGCAAGGTCAAGAGAA
TCTGTAAGCTCAAACGTGGATTATTTATCACTGCATGAACAAATAAAATACCTGAGTCAC
GGTCCATTTAAACTTATGTAAGAGTTAATTCTAAAGAAAGAAGAGTAAAATGAACTTACG
GAGAAGGAAGAAAGATAACTCAAGGAATTAAAGAGACAGGCTGAAGATGAAATATTGAAA
AATGCTGAGGTTATTTGTACTACTTGTGTTGCTGCATTTGATAGAAGATTAAGAAACTTC
AAATTCTCTCAGGTACTTATTGATGAAGCTACATAGGCCACAGAACCAGAAACTTTAATT
CCAATCTTAAGAGGAGCCAAGCATGTAATTTTAGTCGGAGATCACTGCTAACTGGGCCCA
GTTATCATGTGCAAGAAAGCAGCCAAAGCAGGTTTAAATCAAAGTCTCTTCGAAAGATTA
GTATGTTTAGGAATTAGGCCAATTAGATTGTAAGTTCAATACAGAATGCATCCAGTGCTT
AGTGCTTTTCCATCTATGACTTTTTATGAGGGTTCACTTTAAAACGGTATCTCAAAGCAA
GATAGAATTCTCTCAGACTTCAAGTTTTAATGGCCTGCCAGTGAGAAACCCATGATGTTC
TATCATTCAATCAGCAATGAAGAAATTTCAGCATCTGGTACTTCATTCTTGAACAGATAA
GAAGCTTATAACGTAGAGGCACTTGTTACTTAATTCTTGAAATTTGACTTGAAACCTGAA
TAGATTGGTATCATCACACCTTACGAAGGCCAAAAAGCCTTCATCACGAGTTATATGCAG
AGATCAGGTTAACTTGACCCTTCTCTATATAAAGAAATTGAAGTTGCCTCAGTCGATAGT
TTCCAAGGCAGAGAGAAAGACTTCATTTTACTCTCTTGTGTCAGAAGTAATGAAGCATCA
GGCATTGGTTTCCTTAATGATCCCAGAAGATTGAACGTCGCTTTAACTAGAGCAAAGTAT
GGTTTAGTAATCTTCGGAAACGCAAAAGTACTCTCAAAGCATGACTTGTGGAACAATCTC
CTCAACGAATTCAAAAATCAAGGTTGCCTAGTCGAAGGACCTAATATTTTCAACCTTAAA
CCTTGTGTAATTGTACTGAGAAGACCAGTAAAGTACAATCCAGATAAAAGAGACTTCGTG
TTGACAGAAACAGCCTTGAATAACTTTGAGAAATCTTAATAAGCTGCAGTCGGTCACTCA
ACTCCAAGCAGTATCAGAGATGAATTCGATACCAGAAGTGAAATGAGTAAAACAGAAAGC
CAGATTTCATATGGAAACAGAGTGAGTCAGTTTGGATTCACAGATATGTTCGGTTTAAGC
AAATCTTCATAGCCAAGCCATCCCATCACCACAAACACCACCTCACAACTAAAAACTTCA
AATTAAAAGGCTCAAGATAAAAGAGCTAACACATCTTCAAATGCATCAGGACAGATTAAG
TAGTAAGAGTCAATGAGTTCAAAGCAAGGTCGCATGCTCGGAGCAGATAATGATCTGAGC
AACGACTAGTTCTTGAGCAGCATGAAGGGCGGTAAATAATGA


>Contig17825.0.g106(protein)
MQSYQGARPTFMNSGQPKKNTDSNNANLQKQQQNQAQNQPNPNKSNYRYDKEEEKVENWR
NMGGSGTNNAQTSDRSGSSNDATSNIYVSGVSGATQVSTSVNQTNQKGGVGASDFGNKNG
YNNNSAQKKQGGASSFDVFSGKKGAAFQSDDSSSSSEEEEEDFGDDDGRMRRMDDLNNSS
SHFDARSEISESVGSVDLEAVEPYDFNNLPQHACAYCGIHEPECVVKCSIKECNRWFCNG
KGINEYGSHIMLHQVKSRHKEISLHPDSPLKDTVIECYNCSSKNIFLLGFVSAKQEAVII
LLCREPCLSQLSVKDSKWDMENWQALIENKAILSWLVKFPSDFEFKRSRKITASQINKLE
ELWKEKPTAQVGDLNVIQQEKAMQPVLLRYKDPKQYKDIFEPLIKLEADYDKSFKESQTQ
RNIRVRFDYSLNKKKQAFFIFPNEDNIRLVPGDELKLVYEYEGQPKWQSRGHIVRIVNEE
ICLELKNPKGCPNDPDIRFTIEFIWKSTSFDRMRLALKIFMRDEQSLSNYIFYKLLGYNT
QEQFIKTNIPKHLSVPGLPELNHFQMNAVKKALITPLCLIQGPPGTGKTVTSTTLVTHLV
KQKMGKVLVCAPSNIAVDQLTDKINSTGIKVVRMCARSRESVSSNVDYLSLHEQIKYLSH
GPFKLMQELILKKEEQNELTEKEERQLKELKRQAEDEILKNAEVICTTCVAAFDRRLRNF
KFSQVLIDEATQATEPETLIPILRGAKHVILVGDHCQLGPVIMCKKAAKAGLNQSLFERL
VCLGIRPIRLQVQYRMHPVLSAFPSMTFYEGSLQNGISKQDRILSDFKFQWPASEKPMMF
YHSISNEEISASGTSFLNRQEAYNVEALVTQFLKFDLKPEQIGIITPYEGQKAFITSYMQ
RSGQLDPSLYKEIEVASVDSFQGREKDFILLSCVRSNEASGIGFLNDPRRLNVALTRAKY
GLVIFGNAKVLSKHDLWNNLLNEFKNQGCLVEGPNIFNLKPCVIVLRRPVKYNPDKRDFV
LTETALNNFEKSQQAAVGHSTPSSIRDEFDTRSEMSKTESQISYGNRVSQFGFTDMFGLS
KSSQPSHPITTNTTSQLKTSNQKAQDKRANTSSNASGQIKQQESMSSKQGRMLGADNDLS
NDQFLSSMKGGKQ