Identifiers and Description

Gene Model Identifier

Contig7827.0.g36

Standard Name

UNKb

Aliases

Contig7827_0_g36

Description

SAM domain (Sterile alpha motif)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00536 ) SAM domain (Sterile alpha motif)
  • ( pfam00642 ) Zinc finger C-x8-C-x5-C-x3-H type (and similar)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004710307.00293386439118e-45zinc finger CCCH type domain c
ontaining protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7827.0.g36(coding)
ATGTAACACTTTGATATTTCCTTGGAAGCCCAAGATGTGTAAAGAGTATTGAAGGTATAT
TGTGTTGAGACATGCTTCTACAGAACCTACGAGGAGTGCCAATAAAATTTACAAAAAGTG
GCAGTTTATGGATACGCAAATCTAAAGGATGTTCCATCTTGCCATAAATCGCATAGTATG
TAGTAATAGACTAGAAGAGCCCCATTCAATGCCGATGGGACTTTAAGATACAAGGCTAAG
CTGTGTAAACAAATTAAAGAGTAAAATAAACCCGATTAAATAACGCCATAGGATCATCAA
AGATATGTTGTTAATTGTTCACAAGGAGATTAGTGTAAATACTGTCACTCATAATTTGAA
TTTGATTTCCATCCACAAGTCTTTAAAACTTAGTAATGTTAAGAATATCTTTTAAGGGGA
AGTTGCAGTAAGGGCTTTGGGATTTGCTATCAATATCATAAAAGCGAGGAAAGTAGATAC
ATATCTTCGAACAATAATTAAAAGGTAGAAAATTAAAAATTTAATGACAAAAGCCATGCT
AGTAAAACAAACGTAACAAGCAATACCAATTACAGCAATGGAAGAACTGCATCCTCTACT
TATGAACAGGCAAGTCTCAAGATTTAATCTAAAGAGAGTGGAGGGTTGACAAACTACGAT
TTGAGTTTAATAACTTAGTAAAGAACAGTCCATCGCAAAGTATCCGAAACCATGATACTA
GGTAGTAGCTCTTAAAAAAATCAAATCTAATCAAATAACAGCGGACTTTACTCTCCACCT
CATTTGAATAGCAGAAGAAAAAACACCATGGGAAACATGTCTTCATAAAGACATTAGAAA
CATTCTTCATTCTAAATTAACCCGATCGGAAACTCTTCTTAGTAAAGATAGCAAGAATAA
AGCTATCAAACTACAGGCAGAGTTGTGCCATATTTTTAGCCTCAACTTTAAAATTTATCA
GAGAGGTAAAATAGTTATTACGGTACTCAAAACGTACAAATGGCCTAATGTATCCCGTTC
TTAGATTTGAATCTGTTCAAAACAGTTTCTTGCACAAGTGATCCATTAGGACATAATTTA
AAGAAATGCCCCTATTACCACGATTATAAAAAAGATAGAAGAAGAGCCTTAGGATTCTAT
TAATCCGAGAAATGTTGGTACGTTGAAAATCATTAAGAATGCCCCTATGCAGATAATTGT
GACAAAGCACACAACAGAGTCGAGGAGTTCTACCATCCAGATAAATACAAAGCAAAATTT
TGCTCATCTTATCTGAAAAAGATGAAAGAATGTGAATACGGAGAATTCTGCTCTTTCGCT
CATTCTGAAAATGAGCTTTCTGTGGAGCTAATTGAGAAATTTGAACCAGATATGGATTTC
TATCTCTTTCATTTCAAGACAGTATGGTGTCCTTACAGAGAAGATGATCATGAAAGAGAT
GTTTGTGTTTATGCTCATAATTGAACTGGCATACTAAAGGATTTATAACATCTTACAAAG
ATGGTTGCTAGAATGAGTATAGATGTCAGTTCAGTCATGGCTGGAAAGAAAAACACACCT
TATCTCACTGGTTTAAATACTTTCCAAAGACAAGAACTGTATCTTTCCCAACCAACTTCT
ATGTTCCTGTATTAGGCAATGTCTCCTAAGCATGTAACTCAACAGCATTAAAATAACTTA
ACTTAAGCATAAATGCAGTAGATGAACTCATAGGGAAACATCCAGTTGTCTTAGAGTCCA
CCAATGCAAAGAGAAATGGTAAGATAACCGCTCTTTGTGGGGCAGCCAACTTCTTACAGA
AAGGCTTCTGAAGGCAACTTCTATCCATAGAAATCAAATTATTTCTTCTAGACCCAAGGC
TAGTAAATGCAACAACCCCAAATGTTTATGAACAACTAGGGACAGCTTTAACATACCTAT
ACGTCAAATTCAAACTAGCAACTACAAGTTAGTCCTTAGATGTTAAACATGAATCTTAAT
CAAATGATGATGAGCCCATAACAGCAATACAATTAGTAGTAGTAATAGTAGCTATTTTAG
TAGCAATTTATGCAACAACAGCAATACTAGAATCAAATGAGCAACATTGGAATGGGTTAA
GGGAGTATGATGAATCCTAACGCTTCACCCTTAAGGACTTAAACATAAGTTGGTCCTGCT
TTTGATTAAATAAGCTTAGAAAATTAAGAGAAGTTTCTCTTTGGGATGAGTAGTGCTTAA
AGTTCCTTTTCAACTCCAAGCGTCTATGATATATAATAGAAACTTAGAAAGATATCATGC
TAGTCAGCTGACTAATCACTTAATGGTATTTTTATGTCAAACGAGAAGTACGTCATGCCA
AAGCAGTAGCAGCAAATTGGCCAAATAAGTAAGCACTCAAGTACTTCTTAATCCCCAACC
TATGAAGACAAAATATTAATATAGCATTAATAGCATTAACTTCAGTAGCAGTAATAACAA
CAACAGTACTAAGCTCCCTAAGAACTAGTTGGAAGGAACTCATGGTAAAACAACTTCAGA
CCAGGGTCTTTCCACTAGCTACTAGTCGATGAAAGAGATGAAAACTTAAGTGAGGGAAGT
ATTTCAAGCAGTGACGGGGGTGGGAAAGCCAATAGAAACAACACAAAGGCTCGTATATTA
GAAATCATTGCAGAGAAGCCCTCGATGGATGTGCAACTTAACGACGAAGTCTATCGATTT
TTACAAAGCATTGAGCTTGAATTTCTCGCGGAAAACTTTAACGGAGAGCACTCCAAGATT
AGCCTGTAGCAACTTAGGGAGTTAGAAGATGAAAAACTTGAAGAGATTCTTGAGGGAAGC
ATGTATGTTTAGAGAATCAAAAAGGAACTGGCCAGACTTTAAAGCATAGATAACTCACTT
CCAAATGTAGTCAATATTACTGCTATATGA


>Contig7827.0.g36(protein)
MQHFDISLEAQDVQRVLKVYCVETCFYRTYEECQQNLQKVAVYGYANLKDVPSCHKSHSM
QQQTRRAPFNADGTLRYKAKLCKQIKEQNKPDQITPQDHQRYVVNCSQGDQCKYCHSQFE
FDFHPQVFKTQQCQEYLLRGSCSKGFGICYQYHKSEESRYISSNNNQKVENQKFNDKSHA
SKTNVTSNTNYSNGRTASSTYEQASLKIQSKESGGLTNYDLSLITQQRTVHRKVSETMIL
GSSSQKNQIQSNNSGLYSPPHLNSRRKNTMGNMSSQRHQKHSSFQINPIGNSSQQRQQEQ
SYQTTGRVVPYFQPQLQNLSERQNSYYGTQNVQMAQCIPFLDLNLFKTVSCTSDPLGHNL
KKCPYYHDYKKDRRRALGFYQSEKCWYVENHQECPYADNCDKAHNRVEEFYHPDKYKAKF
CSSYLKKMKECEYGEFCSFAHSENELSVELIEKFEPDMDFYLFHFKTVWCPYREDDHERD
VCVYAHNXTGILKDLQHLTKMVARMSIDVSSVMAGKKNTPYLTGLNTFQRQELYLSQPTS
MFLYQAMSPKHVTQQHQNNLTQAQMQQMNSQGNIQLSQSPPMQREMVRQPLFVGQPTSYR
KASEGNFYPQKSNYFFQTQGQQMQQPQMFMNNQGQLQHTYTSNSNQQLQVSPQMLNMNLN
QMMMSPQQQYNQQQQQQLFQQQFMQQQQYQNQMSNIGMGQGSMMNPNASPLRTQTQVGPA
FDQISLENQEKFLFGMSSAQSSFSTPSVYDIQQKLRKISCQSADQSLNGIFMSNEKYVMP
KQQQQIGQISKHSSTSQSPTYEDKILIQHQQHQLQQQQQQQQYQAPQELVGRNSWQNNFR
PGSFHQLLVDERDENLSEGSISSSDGGGKANRNNTKARILEIIAEKPSMDVQLNDEVYRF
LQSIELEFLAENFNGEHSKISLQQLRELEDEKLEEILEGSMYVQRIKKELARLQSIDNSL
PNVVNITAI