Identifiers and Description

Gene Model Identifier

Contig7958.0.1.g71

Standard Name

ULP1b

Aliases

Contig7958_0_1_g71

Description

Ulp1 protease family, C-terminal catalytic domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam02902 ) Ulp1 protease family, C-terminal catalytic domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYIL031W0.00000008001913847069386ULP2 SGDID:S000001293, Chr IX
from 292633-295737, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7958.0.1.g71(coding)
ATGAGAAGCCTTGATATGAGCTCAAGTAAAAACAAAAAAGAAGTCTTAATCTCAGCAATT
TATGATATTCATGGCAATCCTGTGAATAAGATTGTCACACTAACATGCAATAACTATGAT
GCCGCTTATAACAGAGCTAGATCTCAAAGATTTCAAGATAATACCAGTAGACTATAGTTA
AAGCGAAGGAAAAATGTTATAAATGACTAGTCTGATGTTGACTATAATCCAAGTCTTAGC
TCTAAATACTTTAAGGGAAACAGTGGTACTTTACCGATCGGGGGTAAGGTCTCAGGAAGA
AAAGAAAAGAGAGGTAGTTTGGACTCATCAGGGTCAAATGAGTCATTTACTGATAAAAAG
AGAACTTAAAAGCATCTTGACAAGAAACTTTCTCCCAAATCTTTAAAATAAAATCAGTTA
AAAGAGTTTCAACAAGCTAATAAAAGGAAGGAAGAGAAATTAAGCACTAAGAAATCTCCA
AAGAAAGGCTTATCAAAATAATATTAGGAGTCTGCTTAGAATTTCACAAATCCCAAGTAT
TCTTAATAGAATTCTTAACTGTGCTCTTAGTAAGATAAGAATTCATTTCACACCTAGCAG
TAACACTTGAATGAAAAACCAGAGTAGAAGTAGATAGAAAAATCTTTCCCGAAGTATGGC
AGAAATCACATGGAAATTAACAAATACTAATATTATACCAAATAGGAGACTGCCAAAATA
TCATCTGAAAAATAGAGTTAAAAGCAGCAGATGCTATAGTAAAATCTATAGAATAGGCAG
AGTTAATATTGCGTTGATAGATAAGTAGATAGAGAATCTAAATGTTTCAAATAAACATCA
AATGCTTAACAAATAACACAACATAAACTATCTGAAGAAAAGAACTAACAAAAGAAAGGC
AGAAAATCAGTTGAAAAAGGAGAAAACTTTAAAAAGTCCCCTGAAGAAGCAAAACTTAAA
AGCAGATCACCTAAGCAAAATAAAGGCACAAATTCCGCTCTAAAATCCTCTTTAAGTAAA
ATAAAAGCAGTCGGTAAGTAAAGCGGTTAGAAAAGTGACTTATCATCATTTCAAGCTAAT
AAGTAAAAGCGAAGCTAAGAAAAATAAGATGAGGATATGAAAACAGTCTGTTAATAGAAA
GAAATCAGCTAGAAATAAAATCAGGACTAATAAAATACAGAAGAGAGAATAGAGATTAAA
TTCAGTTAGGAGGAGCGAATTAAAAATCTTCCAAGTTTCACACTAAAAAAAGACAAATAA
TCTAAGTTACAAGAAACGGTATAGTTATTAAGCGAAGACAACAATTCAAATGAGGAGAAT
AAAGCCAACTTAAATGTTGGTATGAAAACATTTTTATCAAGACCCTCAACTTTAACTCTA
AACCCATAAAGTTACAATTCTTCAATTACTAAGCATGAGTGGGGATATGTCATAGATACA
CTAAAAGAGAGCGATGTCATCTGCAAGATTGAATTTACTAATCAAGGTAAAACATCTGAT
TAAGAAATTAAGAAAGGGGACTTTCTGAGGCTTGATCCAGAGGTGTACCTGAACGATATG
ATTATCAATTTTTACCTAAATACAGAAAAGTCTTCTACGGTTCACATATGCAGTACATTT
TTCATGTCAAAGTTGTACAACATGAATAGTGTAGAGATTAATGAATTTAGATATCCATCA
GCTAAGCCTCAGATTGACTACGCTGGAGTTCGAAGATGGACAAGATCGATTGATCTATTC
TCAAAAGAGTACATCTTTGTTCCAATCTGTTAAAATGAGCATTGGTCAATTGCTGTAGTT
TGCTTTCCTCAAAGATTAGCGACTTTAATGAACGATCACGCTTAACAGTGCTTAAATGGT
GGCCCACCAGCTCAACCGCAATAACAGGCATAGAATTTGGCTCAACCTTTAAAGTAGTCA
TTGGAAAAGGAGAAGCAAAAGAAGTCAAAGTAGGAACTACGTCAGCAAATGGAGGAAAGA
GCTAAAAGATTCAAAGTTCAACACGATAATGATTCAGAAAATGAGGATGAGAGCGATGAT
AATGAATACTCTAACGAATATGACGAAGAATACGATGAGGAAATGATGGATATTGATGAG
GGTGCAGGCTAAGAGAGAAGCTCTAATGAGGATAATGCAAATGGAATTGGGGGTTTATTT
GGTTAATTTCCAGGCTTATTTAGCAGTAATTCATATAAGAAACCTGCAAAAGTTGATGAT
AGCAAGCCTTATATACTCTATTTTGATTCTATGGGAGACGAGAATTCATCTACAAGTTAA
TAAATAGCTAAAGCTCTAAGATAGTATATGGAGGCAGAATATTTAGACAAAAAGCTAGGA
GATAAGAAAGCTTAATATGAAAAGTATTTCTAGGATTCATAATTTTAATGGACTGGGCTG
AATGATTCTAATATGCCGTTTTATGTTCCAAGATTACCAAAGTAGAAAAATGCCTACGAC
TGTGGTCTCTTTCTTCTAGAATATGCCGAATGTTTTCTAAAAAACCCATAATTTATTGAA
TCTGACCTATAGCAACACAAAAACCAGCTTTTTCGCTAACGAGCAATTCAAGCCAAGAGA
GAAATCCTTAAGAGACTAATAATTTGCTTAGCTAAAAATAAGTAACAACCTGGAAGTACA
GCAAACATTGGAAAAGAATATCGAGACTATAGAGAGACAATTATGGGTAAATTAACATTT
TTAAACAGAGAAGAGCGAAGGCTTTACAATCAAACTTAATTCAAAACACCAACACCCTCT
AAACTGGCCCAATTAGATGGCACTAGTCTTACTTAAAATTTGTAATCACAACTAAACCTG
TGA


>Contig7958.0.1.g71(protein)
MRSLDMSSSKNKKEVLISAIYDIHGNPVNKIVTLTCNNYDAAYNRARSQRFQDNTSRLQL
KRRKNVINDQSDVDYNPSLSSKYFKGNSGTLPIGGKVSGRKEKRGSLDSSGSNESFTDKK
RTQKHLDKKLSPKSLKQNQLKEFQQANKRKEEKLSTKKSPKKGLSKQYQESAQNFTNPKY
SQQNSQLCSQQDKNSFHTQQQHLNEKPEQKQIEKSFPKYGRNHMEINKYQYYTKQETAKI
SSEKQSQKQQMLQQNLQNRQSQYCVDRQVDRESKCFKQTSNAQQITQHKLSEEKNQQKKG
RKSVEKGENFKKSPEEAKLKSRSPKQNKGTNSALKSSLSKIKAVGKQSGQKSDLSSFQAN
KQKRSQEKQDEDMKTVCQQKEISQKQNQDQQNTEERIEIKFSQEERIKNLPSFTLKKDKQ
SKLQETVQLLSEDNNSNEENKANLNVGMKTFLSRPSTLTLNPQSYNSSITKHEWGYVIDT
LKESDVICKIEFTNQGKTSDQEIKKGDFLRLDPEVYLNDMIINFYLNTEKSSTVHICSTF
FMSKLYNMNSVEINEFRYPSAKPQIDYAGVRRWTRSIDLFSKEYIFVPICQNEHWSIAVV
CFPQRLATLMNDHAQQCLNGGPPAQPQQQAQNLAQPLKQSLEKEKQKKSKQELRQQMEER
AKRFKVQHDNDSENEDESDDNEYSNEYDEEYDEEMMDIDEGAGQERSSNEDNANGIGGLF
GQFPGLFSSNSYKKPAKVDDSKPYILYFDSMGDENSSTSQQIAKALRQYMEAEYLDKKLG
DKKAQYEKYFQDSQFQWTGLNDSNMPFYVPRLPKQKNAYDCGLFLLEYAECFLKNPQFIE
SDLQQHKNQLFRQRAIQAKREILKRLIICLAKNKQQPGSTANIGKEYRDYRETIMGKLTF
LNREERRLYNQTQFKTPTPSKLAQLDGTSLTQNLQSQLNL