Identifiers and Description

Gene Model Identifier

Contig15388.0.g29

Standard Name

ULP1a

Aliases

Contig15388_0_g29

Description

Ulp1 protease family, C-terminal catalytic domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam02902 ) Ulp1 protease family, C-terminal catalytic domain

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15388.0.g29(coding)
ATGAAAAATTGCAAAAAGAAGAGTGCTAAGTCCTCATAGATTACATCTTCAAAAAATAAA
AAGAAAGATAATTCAGCAGCAACATCGAAACAGAAAGATCTTCATCACATGCCAAGAAAT
ACTAGAAGTCATAAAGCTCCACAAAACTCTAAAGTGAAGCCATAGTAAACTGTAATTTAA
GCTTCTTAAATAAGCTCAAAATCAAAAGACATCAAGAAAGCTAGCAAAACAAAAATAATT
ATGTCTAAGAATAAACAAGTGAGCATGACTGCTAACACAAGCCCAATAAAGTAATTCAAA
GGCAAAATTGGAAGTTATGAACTCAGAGGTAGGAGTAAGGAAAAAGAAAAATCAAAGAAT
TTACCAACTTTAATGAGTCCTGTGAAAAAAAGGAATGATCCTAAACTCAACAGTCGTACA
AATTCACCAACAAGAATGCAAAGTAAAGATGTAGGGAAGACAAATTAAAGCGAATGCAAG
GATGTTGCTTAAAAAATGGCAATTCCTCGTTAAAATCAAGATACAGAAAGAAAAATTATT
CAGTCAAGAGTTCAGGCAGATAGATATTCAAGAACTCTTAGAATTTAATCTGAAAGAATC
TCCAATTCTAGAGACTCTTAGTCAGCTTCGCCAGTGAAAAATTTGAGGTCAAGGTAAAAC
GGATAAGCAAAGTACATTTCTAAAGAGTAATCCTCATCTCAAATTCTACTTATAAGACCT
GAATTTCTTAGAAATACCAGGTCTTTGTCACCAGTTTTAAAGTTAAAGAATAAACTTGAA
GGCATTAATCAAATCAAGTTCTAATCTCCAATAAAGACAGTGGTTTAAAGTCTATAGAAA
GTCAACTTAAGAAGTAGGAAAGTTGAGAACTCCACTGAAATCAAAGCTTAGACTGATTCA
TAGTAAAATTTGACATAAGATAAGAAGAATTTTAAAATAAATCCCAAGCCAGCAGATAAA
TCCCAAGCTCCGATAAAAAAAGAAATAATTGCTAAAGTCCCTTAATAAGAAGAATTTAAG
AAGCCTTTAACCAGGAACTAGATGCAAGAGAGAATAGTAAGTCCAAAATTCAAAAAACCC
ATTGATAAAGATGTTGTAATGAAAGAGACAGATCAAGATTAGAAACGCTAACTTAGAAGT
GGGCTTTAGCTCTAATAAGCTTAATTATCTAATAATTAATAATAATTGGACAATAAAAAG
CTCAATTAAGGATTACAAGCATCACAAACAAATATCCAATAAGTCGTTTAAGATTAGAAA
ATTATGAACAAATCCCTTTAAAGCAAAGATATAAAGAAAACAAAGAATCCGAAACAACTT
TAGTCAAAAAGAAGAGAAGAATTGAAAGTTGAGAAATCCTATGATTAAAGTGAAGTTGGA
TCAAGCAAGAATTTATAGGAGACAAGACACTATCTCAGAATTCGTAAATAATAAGATTTA
AGCGTGATATAAAAGATCAATAATGTCATAAAATCTAAAGGTAAAGCATTAAAGACTAGT
AAGTCAAAGATAACGAGTTAACTTTCAGCAAAGCAACAAAAAATTACTAAGAATTCTTCT
TCTTCTAAGTCTAAGAAGAAGCTTAAGCATTAAAAAGCAGAACCTTAAGTAACTGATTGG
TACGAAACTCCTCTACAATAAAGATTGATAGAGTAAAAGATTAAACCAAGACTTTTAGTT
TGTGATACCAATTTCGAAGACACCATAATGACCGAAGTCCTAATTGAGGATTAGGAAAAT
TTGGAAGAATGCCAAATTCAGCCAATAAAGTAAGGAAATAAATAATTCAGAAGTCATGAA
AAGCAACGCCGCACATTTAACAAATCAACCAAGTATGACAGTAATAACTAAAGTCCTAGA
ATCACAGATGACTCAGTGCAAATTCTCGAAGGCATTCATCATAAAGAGTTGGCCAGAAAT
CCACAGTAAAATTGGAACCAAAATTTAGATTAACACGAAGTTATGATGATAGATTTGGTT
CAAGAGAGCAATTAGTAATAGCAGTTAGATGGTTAAATTATCACAGTAGACTCCTAAACT
TAATCATTAAATATGGGAATTCAAGTTTTATAGTAAAACTAGCTTGTATTCGACTAGTCC
TCAAGCTAAGTTGACATCGATAATGTGTTTAATTTGCATTCAATAAATCTAATTGGTTAA
AAAGGTAGGTTTCAAGACGATGAATCTAGAGAAGTTTAAGATCCCAGGAAATTTACTCCG
CAGCGAGATAATTAGAGAAGCTTTGAAGAATGTAAAAGTATCGAAAACAGAGATCTTATC
TCAAGTTAAGATGGTGATTAATTAATGAGCAGTGACTCTGACGATGAGTTTGAAAATGAA
GATTAATTTAATGATGTTCATAAAAAAAATTCCAAGTACAACTCAGAAATTAAAAAGAAC
ATATCTTAGAGTTTTCTGTAACAATTGCATTAGCAAAGATTCAGAAATAACAACAGCCAT
ATTTAAATCAATAATCTAAAGTTGCCAGACATGACTCCTATTAACGAGTAAGCAGATATT
TGGAGACTTAGAAAAAATGACTCATTTTTAAATGACAATCTCATTGCCTTCTTCCTCGAA
TTGTTTTATAAGCACTTGCTAGACCAATAAGATCAAAGTGGCGATAATGATAATTTAAAC
TCGATTTTTTAACCTGATGAAATTAAGCTTTGCGACACATTTTTCCTATCTACTTTCTTG
AATATCTTCACTCCATCAACAAACACCTCACAAGTTAAGCCTGATAACAAGTAAATTCCT
AGGTCACAACCTCTCGATAGAAACCCAGAAAACCTGATTTAAACTCTTCAAATGAATACT
CAACTAACTGAGCAAGAGCTAGAAGCCAGAAGTTACAAGGAAGCAGAGAATAAATTTGAA
AGATTTGCAAAGCGCCGTATTTCAAATATCGAAAAAGTCAAGCATATGATTGTGCCAGTC
CACAGGCAAGAAGATTAGCATTGGGCTGTTGCCTTCCTCTGCAATCTCGACAAAAAGTAC
GATGAGGCTAACCTTGCTATTGAAAATCCATGCATAATCTATTGCGATTCGATGTTAGAC
ATCAGCAAAGAAATCTAGCAATCCTTGAACTTCCTCTTACTCTCAATTTACAAAAAGAAG
CATGATAAACTGCCTTTGAAATTAGTTGACCAAGTATCTATGGCAACCTAAAATTCCCCC
TTCACATTTCAAGAACAGTTAACTTAACAAAACTAAAGTTGTCTTTAATCCCCAAATTTA
TTATCCAGTCCACATTCCTTGGAGAGATTTTAATTTAGTTACTTCAGTTCAAGAGTTAAC
CTACCAATGCAAGAAAACGGATTTGACTGTGGATTGTACCTGATTAAAAATACTGAGATG
TTTTTGAGAAAGCCAGAAGCATTTCTAGATGTAAATCTCATACTAGAAAATTAAGAATTC
AATTCAGAGAGTTAGATCAATCAAGATGAAGAGGCAAAGTTTGATGAAGATTAAGAAGAT
AAATAAACTATAACTCCTTCAGCCATATTATATGTAGAACACCAGGACCTTGAGACAAAA
TTCATAAAACTGAACAAATACTTCAAAGAAGCCTATACGATTCATATACTGCAAAATTAA
TAGAAATCTAACGACAGTTCAATGAAGTCAAGCAAGCAAGTATCACCCAATAATTCTAAT
CGAACTGATAAAAGTAAAGAGTCAAAAGATGATGAGAAAGCTTAATTATAGGCAAACTTC
AAACTCAATCAGAAAAAGTTCAAGAATTTCTTCTCCAGTCTTTCAAGTGACAAATAAACA
ATGATTGCAGATCTCTTCCATTCTAAAAACCAGAGTATGAAAAACATTCTACATTTCATG
GGCTTTCTTAAAATAGAAATAGATAAAATATTCTCTTTGAATCCAAAACTTCTTCGTTTG
TGCCAAAAACACCAGTAACTTTAGAATTAGGATTTGAGAACGAATTGGGACATGTCTTTT
TTTTTGCCAGCAAACTTACAAGATTCAAGCGAAAAAGGGAAGCCTAAATTGTAAAATTAC
ATATACAATAATACTCAAATCAGTAAGATGCGATAACACTTGCTAGAAATGATCGATGAT
TTGAAACAAATATAGAGCGCTGATGGTCTTACTATTGATGATAAAATTCAAGAAATCATT
CAAAGTTATCTAAAAAATCAAGAACTTTATCAATGA


>Contig15388.0.g29(protein)
MKNCKKKSAKSSQITSSKNKKKDNSAATSKQKDLHHMPRNTRSHKAPQNSKVKPQQTVIQ
ASQISSKSKDIKKASKTKIIMSKNKQVSMTANTSPIKQFKGKIGSYELRGRSKEKEKSKN
LPTLMSPVKKRNDPKLNSRTNSPTRMQSKDVGKTNQSECKDVAQKMAIPRQNQDTERKII
QSRVQADRYSRTLRIQSERISNSRDSQSASPVKNLRSRQNGQAKYISKEQSSSQILLIRP
EFLRNTRSLSPVLKLKNKLEGINQIKFQSPIKTVVQSLQKVNLRSRKVENSTEIKAQTDS
QQNLTQDKKNFKINPKPADKSQAPIKKEIIAKVPQQEEFKKPLTRNQMQERIVSPKFKKP
IDKDVVMKETDQDQKRQLRSGLQLQQAQLSNNQQQLDNKKLNQGLQASQTNIQQVVQDQK
IMNKSLQSKDIKKTKNPKQLQSKRREELKVEKSYDQSEVGSSKNLQETRHYLRIRKQQDL
SVIQKINNVIKSKGKALKTSKSKITSQLSAKQQKITKNSSSSKSKKKLKHQKAEPQVTDW
YETPLQQRLIEQKIKPRLLVCDTNFEDTIMTEVLIEDQENLEECQIQPIKQGNKQFRSHE
KQRRTFNKSTKYDSNNQSPRITDDSVQILEGIHHKELARNPQQNWNQNLDQHEVMMIDLV
QESNQQQQLDGQIITVDSQTQSLNMGIQVLQQNQLVFDQSSSQVDIDNVFNLHSINLIGQ
KGRFQDDESREVQDPRKFTPQRDNQRSFEECKSIENRDLISSQDGDQLMSSDSDDEFENE
DQFNDVHKKNSKYNSEIKKNISQSFLQQLHQQRFRNNNSHIQINNLKLPDMTPINEQADI
WRLRKNDSFLNDNLIAFFLELFYKHLLDQQDQSGDNDNLNSIFQPDEIKLCDTFFLSTFL
NIFTPSTNTSQVKPDNKQIPRSQPLDRNPENLIQTLQMNTQLTEQELEARSYKEAENKFE
RFAKRRISNIEKVKHMIVPVHRQEDQHWAVAFLCNLDKKYDEANLAIENPCIIYCDSMLD
ISKEIQQSLNFLLLSIYKKKHDKLPLKLVDQVSMATQNSPFTFQEQLTQQNQSCLQSPNL
LSSPHSLERFQFSYFSSRVNLPMQENGFDCGLYLIKNTEMFLRKPEAFLDVNLILENQEF
NSESQINQDEEAKFDEDQEDKQTITPSAILYVEHQDLETKFIKLNKYFKEAYTIHILQNQ
QKSNDSSMKSSKQVSPNNSNRTDKSKESKDDEKAQLQANFKLNQKKFKNFFSSLSSDKQT
MIADLFHSKNQSMKNILHFMGFLKIEIDKIFSLNPKLLRLCQKHQQLQNQDLRTNWDMSF
FLPANLQDSSEKGKPKLQNYIYNNTQISKMRQHLLEMIDDLKQIQSADGLTIDDKIQEII
QSYLKNQELYQ