Identifiers and Description

Gene Model Identifier

Contig140.1.g139

Standard Name

UL6

Aliases

Contig140_1_g139

Description

Herpesvirus UL6 like

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig140.1.g139(coding)
ATGATCCACCACTTGATCCTAAAAACAAAATATTTAAGTAAAGATATTTAAGAGAAGGAA
AGAATACTCACTTCCACCGCCGCCTCTTGGCATTTTACTTTAAAGATAGTTATTAAAAAA
TTATTATAATTCCAAAAATTCAATTTTATTATACTATTTTGGACACAATTTTAATATTGA


>Contig140.1.g139(protein)
MIHHLILKTKYLSKDIQEKERILTSTAASWHFTLKIVIKKLLQFQKFNFIILFWTQFQY