Identifiers and Description

Gene Model Identifier

Contig9853.0.g8

Standard Name

UGGT1d

Aliases

Contig9853_0_g8

Description

hypothetical protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR336W0.0000020007268868677913KRE5 SGDID:S000005863, Chr XV
from 949773-953870, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9853.0.g8(coding)
ATGAAAAAGTCACTGAGTCTACTATTTTCTCTAGGTGTCTCGCTTACTTTAGTAAATATA
GGAAACATCTAATCCAAGGAAGTGAATTTGAAATTTAAGAGTACTTATTGCGTTAAAGAT
CCCATCTACTATGCGCTAGAAGCTTAATATTTCCAAAACCCTGTGACATTCTGGTCATAA
GCGCTAACTTTTAACTCAAATACCTATCTCTAAGACCATCCTATGGCAAAGCACTATGAC
AACCCAGATGATCAGCACAGACTAGAATATTACAATCAACTCGAATAATAAGAATCCGCA
CTGTTTGATACCTAACTATGCCCACTCTGGATCAAAGTGCTTAGTAAAAACTCTAATAAT
GGAGATAAAATAAATTTCAGAACAGTCAACAGTCAAGGTGGTCATTCTAGTACTAATATT
CATTAAGACATTAATCAGGAGGCATAACTTGATCAAAATAGTTACTTTGTGAAAGATATC
TTTTGTGGAATAGACAAATATCTTAGTAACCAAAAACAAGATACTACTAAACTTAACCAA
GGATAATTACCCTCTTCACTCAATGATGATGAAGATACTTAGTACCTACCCCTAGCAGCT
TAATACTTCAGCCATTTCGACACTTTAGATCCTCAAAACGATAAATATCTCATCCAGAAC
TTCAACGACCCTGAGGTCTTAGTGGTATACCTGGATTTCACAGATAAATCCCTCGATATA
TCACATGTTTTCAGCAAACTTGATAATAAAAACATCGTACTTAGGTATAAGTTTATGGGA
GACTGCATTAAATAAGGGCGAGATACTGCTACTGAGCTGCTCAGAGGTGTTGGCATAGAC
TTGAAAGTGTAAAACCCTTAAAGTAAAATGAGAAATGGGGATGATTTGTTCCTTGATACC
TTCTTGTTTAAGAAGAGGTCGCACAAGTTTAGAGCACATGAAATCTATGATCCATACTAA
ACACATATCTTTAATGAAGTTAATAAAGCAAATAACTTATCAGATGTAGCTTTAATATTA
CAAAACCATCCTAACTTTATAATTCATGAGAACAAAACAGACAAAGCAGAGAATATCTTT
AATTTTACAGGCAAAGTATCAAAAGAAGAATTTATAATTATAAATTACAAATGTGTTAGA
TTAGGTCTACACACATCAGATCCAGTGCATCTAAACAAATAAATATAGGAAGTGTTTAAA
AACACTATAATCATTAATAAGTATGTCGATGATCCAACTTAGCTGTACTAAAATATCTTA
ACTTATCATTTTCAGGGCAAACCAGTTTTTATGCCAAGTGAATTATTTTCCGATCAGAAC
ACCATATTCCCTGAAATCCTGTAAAATCTAAATATAGAGAGTACTCCCATTACTAAGTCT
ATAGCTTCAACACTTAACTATAAACATAAGAGGAGCATAGATATTACAGCTTTGAAAAAT
ATTGTCATGCCTAAGTAACTAGAGAATGTTACTCAACCTACGATAGCTATTTAAATAGTA
GCTGATATTTTAGACGCCTAAAATTATGAGATTAGTTTGAAGTTATGTCAAACCATTGCA
TAGATATCAAATAATTAAAACTTGTACATAGAAGTGAGCGTAGTATTTTCTATTCAAGAT
CAACACATAAAAGAATTTAATGATGAAAGTGTTAAAGAAGAGAGGCAAAAGTTATTGTCA
AATAATATTGATAAAATAATCAAAGAAATAAATAGTGGTAAAGAAATTAGACTTAACAAA
GTTTAAATCAAGGCAGCTAGTGACGTTTGCTCAGAATACAATATCTGTGATCATTAATTG
CTAATGGTGATCAACTAGAGAGGAATTGATCTATTATAGCTTAACCAATTGTTAAAATCA
AAATCTTCTGATAAACTATTGTAAAATAGTCTTAGCAACTTGATACTCTAAACTTATCAA
GACTTACCCCAAAATTATTCTACTTACTTAACAAAGAACGACTTTGATCTATATAAAGTA
AATCTTTAGATCCTTTAAGACTAATATCCATAGTCATAATTGAGTACAAGATACTAATTT
AACATTTTAAATCTATTGAAGTTAAGGGAGAACGAATAATCCAAGCTCCCAACTTTGAGA
TTTATTGATGACTTGAAAAATGTTAAATCTGAGCACTATATTCATTTAACTGTACTTACT
TCAAACCCTGAAGAGCTCCAAACTTTTATGTCGATCTATGATAGTTTACCATAAGACATG
AGAGATTAAGTATTCCTGGATACTTAACCAGACACCGAGAAATACATGCTAAGTGGTCAT
ATCACTTCAATTAGTGCATTAAACCTATTTATAAATGGAAATCAAGTCTAACATTAAGGT
TTATCCAAAAGTTTCTTGGTAAGCTTGATTGAAGCTGAATTAGCTAAGATTAGTTACCTA
TTAAAGAATGTTAACTTCAGAGGTCATAATAAACACTTGAAATTAATAAATGAGCTAAGT
CTCATGAATTTAGCTTCAGTCGATAACTAAACTGATAATTTTGATTGTTCTAGAGAATAC
GAAAGAGCAGCAACTCTTTCAAAGTCTAAAAAGAAATTTAAGACAAGTTAAAGCTACCTT
CTTAAGTTGAAAGCTAAGTTTAATACTTTATCAAGAAATTCTTTAAATGCTATATCTTTG
TTGAGCTAATAAAAGTTAGGGGCTTCAATTGAATTATCATTCTTTACCCCTAGATCCCTT
GGCATTCAACTTAGATATTTTGATTCACATTATTTCAAATTGTTTTGGAATGAATATAGT
ATAAGACCTGAAGCTTATAACATAAAACATCATTTCCATCCTAGATTCTCTCAAATGTAC
ATTGACATAGCCCAATCAAGAAGACAGCTGTTTACCCTAGATGTGCTGGACAATTTTAAC
AGTCAATTTTAATTAGATTAATCTGTAAAAGATCAAGCTGTCTTTGGAGTTAGTGGATAT
ACTTTGCAAATGGATCTAAAAAAACTTACTCTATAAAATAAAGTCAATAGTGATGACTTT
ATCAAAGTGGAGTTTAAGCAAACTAAAATGAATCAACTCTTGAGATTAGATTAAACTTCA
AAATCTGATAGCTTCGCAAAAGAGAGCTTTATGATTACTAATGAAAGAGGGCAAATAGTA
AACTATGCAAAAGCCATTTTGGATTAATACATTTAACTTGTTCTTCCAGGACCTGGTAAA
TATTTAATGATTAATGAGAAGACTCTTAGTATTGAAATCATTAACTACGATTCAGTAGTG
TACTAATCAAATGAAATTCCATTAATGCATTTCGATTAAAGATTAAACTTAGAAAACCCT
CAATTAGACTACACTACTCAATACTCTAAGACTCAGCCAATTCCCTATTAAAACACAATC
TAGTTGAGCTCATTATCAACAAAAACAATTTAATCAAAAGATTACATTAACTTATTTTAC
ACAGTATCAGGTGGCCTCTACGAAGCCATGGCTCTTCATTAAATCTATTAGTTACTGCAA
TTCTTCCCTTAATAAAATTTCAAGCTGTTTATCTATGAAGGTATCTACTGCAGTCCTGAT
TTCAAGATTAGATTGAGGAATTTATTGACTTATCACTCAAACTTCGCAATTAAGTTCATA
AATTACCCCTGGCCTGAAGAACTTGTTCATTTAGACTTCTCTCCAAAGAGACAAATCAAT
CTCTACAGAATTATGTTCTTGGATAACATATTCCCACCAGATGTAGATAGAGTTATCTAT
AGGGATGCTGATTAGTGCAATCTCAATCACTCAGATCTTAGTGAGTTAGTTTCTTACAAT
ATGAAAGGATATCCACAGGGATAAGTTAAACACTGTTCATTCTTTGGTGGTAAAGGTTAC
GATCCCAACCAAATCATGCGTCAGCTGAAAAAGAATTTTGTTTACTATACAAACAACATA
ATCTTGTTGGACATTAAGGTTTTCAGAGAGACTACCTACTCTGATGCTATGATCAATTAT
TACCAATTTAGAGTCAGAGAAAACGGTTTCGATCCATTCTTACTTTCTTAAGATCTCTAA
AGCCCTGCTCAAGATGTGGTACCTATTTACCCACTTCCAGAGGAATGGTCTTGGGCTGAA
GACTTTTGTGATCCAGCTAAAAGGGAGAAAGCAAAATTAATAGATTTCCAAGATATGAAG
AGAGAAAATAAATTACAGATTGCCAAGAGAGTGTGCCCTGGCTTTGAACATGGCTTCGTA
GAAATGATTAACAAAGTCCAGAAACCTAACATTAATATTACATAAGAATGA


>Contig9853.0.g8(protein)
MKKSLSLLFSLGVSLTLVNIGNIQSKEVNLKFKSTYCVKDPIYYALEAQYFQNPVTFWSQ
ALTFNSNTYLQDHPMAKHYDNPDDQHRLEYYNQLEQQESALFDTQLCPLWIKVLSKNSNN
GDKINFRTVNSQGGHSSTNIHQDINQEAQLDQNSYFVKDIFCGIDKYLSNQKQDTTKLNQ
GQLPSSLNDDEDTQYLPLAAQYFSHFDTLDPQNDKYLIQNFNDPEVLVVYLDFTDKSLDI
SHVFSKLDNKNIVLRYKFMGDCIKQGRDTATELLRGVGIDLKVQNPQSKMRNGDDLFLDT
FLFKKRSHKFRAHEIYDPYQTHIFNEVNKANNLSDVALILQNHPNFIIHENKTDKAENIF
NFTGKVSKEEFIIINYKCVRLGLHTSDPVHLNKQIQEVFKNTIIINKYVDDPTQLYQNIL
TYHFQGKPVFMPSELFSDQNTIFPEILQNLNIESTPITKSIASTLNYKHKRSIDITALKN
IVMPKQLENVTQPTIAIQIVADILDAQNYEISLKLCQTIAQISNNQNLYIEVSVVFSIQD
QHIKEFNDESVKEERQKLLSNNIDKIIKEINSGKEIRLNKVQIKAASDVCSEYNICDHQL
LMVINQRGIDLLQLNQLLKSKSSDKLLQNSLSNLILQTYQDLPQNYSTYLTKNDFDLYKV
NLQILQDQYPQSQLSTRYQFNILNLLKLRENEQSKLPTLRFIDDLKNVKSEHYIHLTVLT
SNPEELQTFMSIYDSLPQDMRDQVFLDTQPDTEKYMLSGHITSISALNLFINGNQVQHQG
LSKSFLVSLIEAELAKISYLLKNVNFRGHNKHLKLINELSLMNLASVDNQTDNFDCSREY
ERAATLSKSKKKFKTSQSYLLKLKAKFNTLSRNSLNAISLLSQQKLGASIELSFFTPRSL
GIQLRYFDSHYFKLFWNEYSIRPEAYNIKHHFHPRFSQMYIDIAQSRRQLFTLDVLDNFN
SQFQLDQSVKDQAVFGVSGYTLQMDLKKLTLQNKVNSDDFIKVEFKQTKMNQLLRLDQTS
KSDSFAKESFMITNERGQIVNYAKAILDQYIQLVLPGPGKYLMINEKTLSIEIINYDSVV
YQSNEIPLMHFDQRLNLENPQLDYTTQYSKTQPIPYQNTIQLSSLSTKTIQSKDYINLFY
TVSGGLYEAMALHQIYQLLQFFPQQNFKLFIYEGIYCSPDFKIRLRNLLTYHSNFAIKFI
NYPWPEELVHLDFSPKRQINLYRIMFLDNIFPPDVDRVIYRDADQCNLNHSDLSELVSYN
MKGYPQGQVKHCSFFGGKGYDPNQIMRQLKKNFVYYTNNIILLDIKVFRETTYSDAMINY
YQFRVRENGFDPFLLSQDLQSPAQDVVPIYPLPEEWSWAEDFCDPAKREKAKLIDFQDMK
RENKLQIAKRVCPGFEHGFVEMINKVQKPNINITQE