Identifiers and Description

Gene Model Identifier

Contig21591.0.g23

Standard Name

UGGT1c

Aliases

Contig21591_0_g23

Description

Glycosyl transferase family 8

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam01501 ) Glycosyl transferase family 8
  • ( pfam08532 ) Beta-galactosidase trimerisation domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR336W0.000000030002053728821195KRE5 SGDID:S000005863, Chr XV
from 949773-953870, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21591.0.g23(coding)
ATGAGAGAACTTTTTGAAACTGATTTGAAAGGCAAGTTATATGGCTTTGTCCCACACTGC
AAATTACTAGATACTTATTTTATAAGTGGATATTGGAAAAAGTTATTGAAAGATAGAGGG
TTAGATTATTATTTTGGGGGTTTATTCCTTGCAGATATTGCCAAGTTTAGAGAAGAATAT
GGGTACTCAGAATATTTGAGAAGGTCATATCAAAGATTCACATAAGATGAAATTAATGAA
AATTTGGTGTTGATGGATCAAGACTTGATTAATTACGCATAAATAAACATTCCAATTCAC
AGATTGTCAACTAAATGGCTATGGTGTGAAGCTTGGTGTGATAAAGAGGATGAAGAATAG
GCTATGATTATAGATTTTTGCACTGATCCATATATGCTAAAAGAAAGCAAGTTTGAAAGG
GCTAAAAGGATTATTCATGATTATTAAGAATAGTATGAAGATATTATTTATTTATTGTCT
TGA


>Contig21591.0.g23(protein)
MRELFETDLKGKLYGFVPHCKLLDTYFISGYWKKLLKDRGLDYYFGGLFLADIAKFREEY
GYSEYLRRSYQRFTQDEINENLVLMDQDLINYAQINIPIHRLSTKWLWCEAWCDKEDEEQ
AMIIDFCTDPYMLKESKFERAKRIIHDYQEQYEDIIYLLS