Identifiers and Description

Gene Model Identifier

Contig22547.0.g72

Standard Name

UGGT1b

Aliases

Contig22547_0_g72

Description

hypothetical protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR336W0.000005998506718272351KRE5 SGDID:S000005863, Chr XV
from 949773-953870, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22547.0.g72(coding)
ATGAAAAAGTCACTGAGTCTACTATTTTCTCTAGGTGTCTCGCTTACTTTAGTAAATATA
GGAAACATCTAATCCAAGGAAGTGAATTTGAAATTTAAGAGTACTTATTGCGTTAAAGAT
CCCATCTACTATGCACTAGAAGCTTAATATTTCCAAAACCCTGTGACTTTCTGGTCGTAA
GCGCTAACTTTTAACTCAAATACCTACCTCTAAGATCATCCTATGGCAAAGCACTATGAC
AACCCAGATGATCAGCACAGACTGGAATATTACAATCAACTTGAACTATAAGAATCCACA
CTGTTTGAAACCTAACTATGCCCACTCTGGATCAAAGTGCTTAGTAAACACTCTAATAAT
GGAGATAAAATAAATTTCAGAACAGTCAACAGTCAGGGTGGTCATTCTAGTACCAATATT
CATTAAGACATTAATCAGGACGCATAACTTGATCAAAATAGTTACTTTGTGAAAGATATC
TTTTGTGGAATAGACAAATATCTTAGTAACCAAAAACAAGATACTACTAAACTAAATCAA
GGAACATTACCCTCTTCACTCAATGATGATGAAGATACTTAACACTTACCACTAGCCGCT
TAATACTTTAGCCATTTCGACACTTTAGATCCTCAAAACGATAAATATCTCATCCAGAAC
TTAAACGACCCTGAGGTTTTAGTGGTATACCTAGATTTCACAGACAAATCTTTGGATATA
TCACATGTTTTCAGCAAACTTGAGAATAAAAACATCGTACTTAGGTATAAGTTTATGGGA
GACTGTATGAAACAAGGGCAAGATACTACTACTGAGCTGCTCAGAGGTGTTGGCATTGAC
TTGAAAGTGCAAAACCCTCAGAGTAAAATGAGAAATGGGGATGATTTGTTCCTTGATACT
TTCTTGTTTAAGAAGAGGTCGCACAAGTTCAGAGCACATGAAATCTATGATCCTTACTAA
ACACACATCTTTAATGAAGTAAATAAAGCTAATAACTTATCAGATGTAGCTTTGATATTA
CAAAACCATCCTAACTTCATAATTCATGAGAACAAAACAGACAAAGCTGAGAATATCTTC
AATTTTACAGGCAAAGTAACAAAAGAAGAATTTATAATTATGAATTACAAATGTGTAAGA
TTAGGTTTGCACACCTCAGATCCAGTGCATCTAAACAAATAAATACAAGAAGTATTTAAG
AACACTATGATCATCAATAAGTATGTCGATGACCCAACTTAGCTGTACTAAAACATCTTA
ACATATCATTTCCAGGGCAAACCAGTTTTTATGCCAAGTGAATTGTTTTCCGATCAGAAC
GTCATCTTCTCTGAAATCTTGTAAAATCTTAATATTGAAAGTACTCCCACTGCTAAGTCT
ATAGCTTCAACACTTAACTATAAACATAAGAGAAGCATAGATATAACAGCTTTGAAAAAC
ATTGTCATTCCTAAGTAGCTAGAAAATTTCACTCAACCTACGATTGCAATACAAATAGTA
GCTGACATTTTAGACGCCTAAAATTATGAAAAAACTCTGAAATTATGTCAAACAATTGCA
TAAATTTCCAATAATTAAAACTTATACACAGAAGTAAGCGTAGTATTTTCTATTCAAGAT
CAACACATAAGTGAATTTAATGATGATAGTGTTAAAGAAGAGAGGCAAAAATAATTGTCA
AATAATATTGATAAAATAGTCAAAGAAATTAAGAGTGGTAAGGAAATTAGACTAAACAAA
GTTTAAATCAAGGCAGCTAGTGACATTTGTTCAGAATACAATATCTGTGAACATTAATTG
TTTATGGTGATTAACTAGAGAGTAATTGACCCATTATAATTGAACCAATTGTTCAAATCT
CAATCTTCTGAAAAACTATTGTAAAACAGTCTTAGCAACTTGATACTCTAAACTTATTAA
GACTTACCACAAAACTATTCTACTTACTTAACAAAGAACGACTTTAACCTGTATAAAGTA
AATCTCTAGATCCTTCAAGACTAATATCCATAATCATAATTGAGTACAAGATACTAATTT
AACATTTTAAATCAATTGAAGTTAAGGGAAAACGAATAATCCAAGCTGCCAACTTTGAGA
TTCATTGATGACTTGAAAAATGTAAAATCTGAACACTATATACATTTGACTGTACTTACT
TCAAACCCTGAAGAGCTCCAAAATTTCATGTCTTTGTATGATAGTTTACCATAAGACCTG
AGAGATTAAGTATTCCTAGATACTCAACCAGACACCGAGAAATACATGGTAAGTGGTCAT
ATCACTTTAATTAGTGCATTAAATCTATTTATAAATGGAAATCAAGTCTAACATTAAGGT
TTATCCAAAAGTTTCTTGGTAAGCTTGATTGAAGCTGAATTAGCCAAGATAAGCTACCTA
TTAAAGAATGTTAACTTCAGAGGGCATAATAAACTCTTGAAATTAATCAATGAGCTAAGT
CTCATGGATTTAGCTTCAATCGATAACTAAACTGATAATTATGATTGTTCTAGAGAATAC
GAAAGAGCAGCAACTCTTTCTAAGTCAAAGAAGAAATTTAAGACAAGTTAAAGCTACCTT
CTTAAGATGAAAGCTAAGTTTAATACTTTATCAAGAAATTCTTTAAATGCTATCTCTTTG
CTTAGCTAATAAAAGTTAGGGGCTTCAATTGAGGTATCATTCTTTACCCCTAGATCTCTG
GGTATTCAACTTAGATATTTAGATTCACATTATTTCAAATTGTTTTGGAATGAATATAGC
ATAAGACCTGAAGCTTATAACATAAAACCTCATTTCCATCCTAGATTCTCCTAAATGTAC
ATTGACATAGCCTAATCGAGAAGATAGCTATTTACCCTAGATGTGCTGGACAATTTTAAC
AGTCAATTTTAATTAGATTAATCGATAAAAGATCAAGCTGTTTTTGGAGTTAGTGGATAT
ACTTTGCAAATGGATCTTAAAAAACTAGCTCTATAAAATAAAGTCAATAGTGATGGATTT
ATCAAAGTGGAGTTTAAGCAATCTAAAATGAATCAATTATTGAGACTGGATTAAACTTCA
AAATCTGATAGCTTAGCAAAAGAGAGCTTTATGATAATTAATGAAAGAGGATAAATAGTA
AATTATGCAAAAACCATTTTGGATTAATACATTCAACTAGTCTTACCAGGACCTGGTAAA
TATTTAATGATTAATGAGAAGACTCTTAGTATTGAAATCATAAACTACAATTCAGTAGTG
TACTAATCGAATGAAATTCCAGTAATCCATTTTGATTAAAGATTAAACTTAGAAAATCCT
TAATTAGACTACACTACTCAATACTCTAAGACTCAGCCTATGCCCTATTAAAACACAATT
TAGTTGAGATTATTATCAACAAAAACAACATTATCAAAAGATTACATTAACTTATTTTAC
ACAGTATCAGGTGGTCTCTACGAAGCCATGGCACTTCATTAAATCTATCAGTTACTACAA
TTCTTCCCTTAATAGAATTTCAAGCTGTTTATCTATGAAGGTATCTACTGCAGTCCTGAT
TTCAAGATTAGATTGAGGAATTTATTGACTTATCACACAAATTTCGCAATTAAATTCATA
AATTACCCTTGGCCAGAACAACTTGTTCATTTAGACTTCTCCCCAAAGAGACAAATAAAT
CTATACAGAATTATGTTCTTGGACAACATATTCCCACCAGATGTAGATCGAGTTATCTAT
AGAGATGCTGATTAGTGTAATGTCAATCATTCTGATCTTAGTGAATTGGCTTCTTACAAT
ATGAAAGGATATCCTCAGGGCTAAGTTAAGCACTGTTCATTCTTCGGCGGTAAAGGTTAC
GATCCCAACCAAATCATGCGTCAGCTGAAAAAGAATTTTGTTTATTACACAAACAACATA
ATCTTATTAGACATTAAGGTATTTAGAGACACTACCTACTCTGATGCTATGATAAATTAT
TATCAATTTAGAGTAAGAGAAAACGGCTTCGATCCATTCTTGCTTTCATAAGATCTCCAA
AGCCCAGCTTAAGATGTGGTACCAATTTACCCACTCCCAGAGGAATGGTCTTGGGCTGAA
GACTTCTGTGATCCAACTAAGAGGGAAAAAGCAAAGTTAATTGATTTCTAAGACATGAAG
AGAGAAAATAAATTACAGATTGCCAAGAGAGTATGCCCTGGCTTTGAGAACGGCTTCGTT
GAAATGATTAATAAAGTCCAGAAACCTAACATTACTATTACTTAAGAATGA


>Contig22547.0.g72(protein)
MKKSLSLLFSLGVSLTLVNIGNIQSKEVNLKFKSTYCVKDPIYYALEAQYFQNPVTFWSQ
ALTFNSNTYLQDHPMAKHYDNPDDQHRLEYYNQLELQESTLFETQLCPLWIKVLSKHSNN
GDKINFRTVNSQGGHSSTNIHQDINQDAQLDQNSYFVKDIFCGIDKYLSNQKQDTTKLNQ
GTLPSSLNDDEDTQHLPLAAQYFSHFDTLDPQNDKYLIQNLNDPEVLVVYLDFTDKSLDI
SHVFSKLENKNIVLRYKFMGDCMKQGQDTTTELLRGVGIDLKVQNPQSKMRNGDDLFLDT
FLFKKRSHKFRAHEIYDPYQTHIFNEVNKANNLSDVALILQNHPNFIIHENKTDKAENIF
NFTGKVTKEEFIIMNYKCVRLGLHTSDPVHLNKQIQEVFKNTMIINKYVDDPTQLYQNIL
TYHFQGKPVFMPSELFSDQNVIFSEILQNLNIESTPTAKSIASTLNYKHKRSIDITALKN
IVIPKQLENFTQPTIAIQIVADILDAQNYEKTLKLCQTIAQISNNQNLYTEVSVVFSIQD
QHISEFNDDSVKEERQKQLSNNIDKIVKEIKSGKEIRLNKVQIKAASDICSEYNICEHQL
FMVINQRVIDPLQLNQLFKSQSSEKLLQNSLSNLILQTYQDLPQNYSTYLTKNDFNLYKV
NLQILQDQYPQSQLSTRYQFNILNQLKLRENEQSKLPTLRFIDDLKNVKSEHYIHLTVLT
SNPEELQNFMSLYDSLPQDLRDQVFLDTQPDTEKYMVSGHITLISALNLFINGNQVQHQG
LSKSFLVSLIEAELAKISYLLKNVNFRGHNKLLKLINELSLMDLASIDNQTDNYDCSREY
ERAATLSKSKKKFKTSQSYLLKMKAKFNTLSRNSLNAISLLSQQKLGASIEVSFFTPRSL
GIQLRYLDSHYFKLFWNEYSIRPEAYNIKPHFHPRFSQMYIDIAQSRRQLFTLDVLDNFN
SQFQLDQSIKDQAVFGVSGYTLQMDLKKLALQNKVNSDGFIKVEFKQSKMNQLLRLDQTS
KSDSLAKESFMIINERGQIVNYAKTILDQYIQLVLPGPGKYLMINEKTLSIEIINYNSVV
YQSNEIPVIHFDQRLNLENPQLDYTTQYSKTQPMPYQNTIQLRLLSTKTTLSKDYINLFY
TVSGGLYEAMALHQIYQLLQFFPQQNFKLFIYEGIYCSPDFKIRLRNLLTYHTNFAIKFI
NYPWPEQLVHLDFSPKRQINLYRIMFLDNIFPPDVDRVIYRDADQCNVNHSDLSELASYN
MKGYPQGQVKHCSFFGGKGYDPNQIMRQLKKNFVYYTNNIILLDIKVFRDTTYSDAMINY
YQFRVRENGFDPFLLSQDLQSPAQDVVPIYPLPEEWSWAEDFCDPTKREKAKLIDFQDMK
RENKLQIAKRVCPGFENGFVEMINKVQKPNITITQE