Identifiers and Description

Gene Model Identifier

Contig1215.0.g18

Standard Name

UGGT1a

Aliases

Contig1215_0_g18

Description

Glycosyl transferase family 8

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

  • transferase activity, transferring glycosyl groups (IEA) | GO:0016757

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR336W0.0000008998839737394744KRE5 SGDID:S000005863, Chr XV
from 949773-953870, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1215.0.g18(coding)
ATGGATAACACAGATCATAGCAACATAGTATTTCATTTCATAGATTAACCTTCTCTTTCT
CCATTATTTAAAGAAAGACTTCAAAATATGTAAAACTTCTACAAATTCTAAGTGAAGTTT
ATTCAATATAAATGGCCATAAGTTCTATTTAAAGACTTGTAAAACAAGAGGCAGATATAT
GCATATATGGTTCTGTTTCTAGATTTAATGATCCCTGATGAAGAAATAGACAGACTCATT
ATTATGGATGTAGATCAAATTGTTAAGCGTGATATTTCTGAGCTTGCTTTTGATATAGAT
TTGAATGGAAAGCCAATTGCTATGGTACCTCATTGCAATTCTTAAAGTTCATTTGATTAG
TCCCCATTCTGGCTTGAGACCTTAATTAAACAAGGGAAGTAATACTATTTCTCAGGTATA
ATACTATTGGATCTACCATTATTCCGACAAAAAGGTTTTGGGAACATTTTGCGTAAAAAT
TACTAATTTTTAGAATTTGAGTAGCAACAAGCTGAAAATTTACAATTGCTTGATTAAGAT
TTGCTAAATTACAGTTAGTTAACAGTTCCTATTCATGCTCTTGACTCAAAATGGTTGTGG
TGCGAAGCTTGGTGTGAGAAAGGTTAATAGAATTAAGCTTATATAATTGATTTATGCGGA
GATCCACATGTTCACATAGGAGAAGGGAAAATCTAGAAATATAAGAGATTGGAGCCTGAA
GCATTTTAGAGATATCTCAATATAGTTAAAGAGTTGATATGA


>Contig1215.0.g18(protein)
MDNTDHSNIVFHFIDQPSLSPLFKERLQNMQNFYKFQVKFIQYKWPQVLFKDLQNKRQIY
AYMVLFLDLMIPDEEIDRLIIMDVDQIVKRDISELAFDIDLNGKPIAMVPHCNSQSSFDQ
SPFWLETLIKQGKQYYFSGIILLDLPLFRQKGFGNILRKNYQFLEFEQQQAENLQLLDQD
LLNYSQLTVPIHALDSKWLWCEAWCEKGQQNQAYIIDLCGDPHVHIGEGKIQKYKRLEPE
AFQRYLNIVKELI