Identifiers and Description

Gene Model Identifier

Contig20140.0.g26

Standard Name

UBXN11

Aliases

Contig20140_0_g26

Description

SEP domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009452205.000891205279872e-66hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20140.0.g26(coding)
ATGGATTTTAAGAAAGGTAACTGGAACCCAACAGCTGGTTTCAACTTTGACAATTTATCA
GCAGACATTCTTGATGATAAAATGGCAAAGAATATTATTGGAGATTTAAGAAAGAATTTA
CCTCCAGGAGGATTCCCCAAACATAAACCTGTGATTTCTGGTGGTACTCCAAGCACTGGT
CTTGCCTCAGCTAAAGCTAAAAGAGGTGTTTCATCAAACGATTAGGACTTAGTATCGAAG
ATGGCTTCAAGACTGTAATAGCTAGAGCAAATCAATCAAGCATTAAGAAGTGAAATTAAG
GAGAAAAGTTAAAAGATTGAAACTTTAGAGAAGGAAAACTTTATCTTGTAAAGTTCAGCC
TCATCTGACTTCGCAAGGACTTTGAAGGAAACTCAAGCTGAGAGAGATTAGTACAAGGTA
TAATGCAAGGAAATGGAAACATTCTTATAAGACTATGGACTTAAATGGGTTGGGAAAGAT
GGAGCAAAGGAAGGAAAGTTTGACGATAAACAAATCAATTAAGAATTGGCACATCTTAAG
CCAACATACAAGAATAATTTGCCCTCTGAAATAGACACTGAAGTATTAACGAGAAGAATC
GAGGAGCTAAACTTTATTGCAGAGAAGCAAAGAGTAGTTAAAAATAGAGATGGCTTACAT
CAATTCTAAAAGCACAATGAAGTATTAATTTTCTTCTTTAAAAATGGACTTATCATCAAA
GGGTTCCCATTCTACCCATATTATTCGAAGGAAGCATAAAGTGTTTTATCAGATATTCTA
GATGGCTATTTCCCTTATGATTTAAAGAAAAAATACCCTGAGGGAGTACCTTTAAAACCT
GTAGACTGCACTGATGATACTTACAGCTCAGAGATCAAAGGTAATCCAAAATTCAAAAAT
TTTGGAGACCTTGAGAAGGATACAAACCCAATGTCCAAAGAAGAATTTCTAAACCAATTC
CCTAAGGAAGTAATTAAAGCAGGAAATATTATACCAATTAGAGAGGAGCTTGAAAAGCGT
TTCAAAGACACTTAGGAGTTGGACGTTAGTAAACTTAGCTCAAATGAACCAATTATTATT
GAAAACGATATTTCAAGAAACATTGCACAAATCCCACCTTCAGATATTGTTACAATGAGA
ATCAGATCTGAAACTGGAAAGAGAACTCTTATCTTGAAATTGCTTATTTCTGATTAAGTC
GGGAAAGTTTATCAAGCTGTTTCACCATATCTCGAGAATAGAGGTAAGAACTTCGAAATT
AGAACAACATTCCCAAATAAAGCTTATGCTGAAGATGAAATAAAGACTCTAAAGGAACTT
GGGTTGGCTCCTTCATGTGCTCTAGTTATTCAGTTAAAATGA


>Contig20140.0.g26(protein)
MDFKKGNWNPTAGFNFDNLSADILDDKMAKNIIGDLRKNLPPGGFPKHKPVISGGTPSTG
LASAKAKRGVSSNDQDLVSKMASRLQQLEQINQALRSEIKEKSQKIETLEKENFILQSSA
SSDFARTLKETQAERDQYKVQCKEMETFLQDYGLKWVGKDGAKEGKFDDKQINQELAHLK
PTYKNNLPSEIDTEVLTRRIEELNFIAEKQRVVKNRDGLHQFQKHNEVLIFFFKNGLIIK
GFPFYPYYSKEAQSVLSDILDGYFPYDLKKKYPEGVPLKPVDCTDDTYSSEIKGNPKFKN
FGDLEKDTNPMSKEEFLNQFPKEVIKAGNIIPIREELEKRFKDTQELDVSKLSSNEPIII
ENDISRNIAQIPPSDIVTMRIRSETGKRTLILKLLISDQVGKVYQAVSPYLENRGKNFEI
RTTFPNKAYAEDEIKTLKELGLAPSCALVIQLK