Identifiers and Description

Gene Model Identifier

Contig8551.0.g85

Standard Name

UBX4

Aliases

Contig8551_0_g85

Description

UBX domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002945802.0006622580855403e-35UBX domain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8551.0.g85(coding)
ATGTCAGAAGTTCGATTGTTCCTGAGTGATCTCGCCAGATCAATGGGCAAAGACCCCTCT
ATGATGGAAAACTTCATCTAAACACTAGAGGATAATTGGCTCGAAACTGTTGATGCTCTG
AAAAGTGTAACAAATGAACAGTGGATTGAGCTCAAGCTTCCAATGGGTGTAGTTAATTAA
ATAAAGAAAAGATTACAAGAGACTGGGGGAGATGTTTAAATGCAAACAAGTGGTTCAGCA
CAAAGCATGGGAACTGGTATTTAAATGGGTGCTTAAGTTAAGTAGCCAGTGAAACTTTAA
GATCAAGAGATGATTGACACATCTTCAGGTTTTAGCAGCAACAATCAAGGCAGTAGAAAT
TACGAAGAGCACAAATAGAGTGATTTGAAGGTTGAATGTCTACAAGCATTGACTAACTTG
AACATTGAACAATCAGTTGATATTTCAGCACACAGAGACACCATTCAGACTCTTTTGAAG
ATTGTTGCAAATTTAATCACTAAGCCCCTAGATCCTGCAGTGAGAAGATTAAACAAAACT
AATGCCACAGTCCAGAAAAAGATTCTTAATCATCAATATGCTTGTTAGTTCTTGTAATTG
GTTGGCTTTGACTTCAACAAGAGCCTAGACTAAGTAGAGATAGGCCATTACTCCAAAGAT
TAACTATTGATAGGTCAAGATGCAATTAATGAACACATTGGCAACTTGGGTGGTTCAATA
AAAACACCAGTCTTTGATCCTTACTCCTCTTCTATTTCTAGTACCACTTTCAATAAGTTG
CCTGTTTAGACTGATCCAAATGCTCAGATAAACTTCTACGACCCCTCTCAAGTGACTGGT
GAGATTCAAAAGATCTAACAGGAGAGATAGAAGGCAATGAATCAAGCTTAAGTTGTTGAT
CGTGATATCAAGGTCTTTAATGCTCAATCAAAGGGAACTAACTTGAAGCATTACCTCATG
GAATTAGACAGAATTGAAATCGAGAGATTGAAAGAACTTAAAATGACTGAGGAGAAGTTG
GAAGAAGCCATTGCCAGCAAGCAAGCACTCATGTTTATGGCTGAAAATGAGAAGCAGAGT
CATTTCAGAAATAAGAGATAAGATGAGTTGGAGAAGATCACCAAGTAAGTTGTCTATACC
ACTGCACTTGTGAGAATCAAGTTCCCTGATGACTATGTTTTGCAAGGACACTTTGGAGCT
TTAGAGAAAGTGGAAGCTTTATATCAATTTGTAAGAGAACATTTATACACCCCTGAGAGA
CCATTCATCTTGTACTAAGCACCCCCAAAGAAAAACCTCGAAGACCATAGATAAAACTTG
AAATAAGTGAGATTAGTACCAAGCGGCACAGTTCTCTTTGAATGGGTTGGATTAGAGCAG
ACCAGAATGGAGGATGGCCCATTTTTGGACATTGCTGGCCTCAGAGATAAAATCATTGCA
TTCTGA


>Contig8551.0.g85(protein)
MSEVRLFLSDLARSMGKDPSMMENFIQTLEDNWLETVDALKSVTNEQWIELKLPMGVVNQ
IKKRLQETGGDVQMQTSGSAQSMGTGIQMGAQVKQPVKLQDQEMIDTSSGFSSNNQGSRN
YEEHKQSDLKVECLQALTNLNIEQSVDISAHRDTIQTLLKIVANLITKPLDPAVRRLNKT
NATVQKKILNHQYACQFLQLVGFDFNKSLDQVEIGHYSKDQLLIGQDAINEHIGNLGGSI
KTPVFDPYSSSISSTTFNKLPVQTDPNAQINFYDPSQVTGEIQKIQQERQKAMNQAQVVD
RDIKVFNAQSKGTNLKHYLMELDRIEIERLKELKMTEEKLEEAIASKQALMFMAENEKQS
HFRNKRQDELEKITKQVVYTTALVRIKFPDDYVLQGHFGALEKVEALYQFVREHLYTPER
PFILYQAPPKKNLEDHRQNLKQVRLVPSGTVLFEWVGLEQTRMEDGPFLDIAGLRDKIIA
F