Identifiers and Description

Gene Model Identifier

Contig1195.1.g74

Standard Name

UBP1e

Aliases

Contig1195_1_g74

Description

Zinc-finger of the MIZ type in Nse subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam11789 ) Zinc-finger of the MIZ type in Nse subunit
  • ( pfam13639 ) Ring finger domain
  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam12678 ) RING-H2 zinc finger
  • ( pfam13445 ) RING-type zinc-finger, LisH dimerisation motif
  • ( pfam12861 ) Anaphase-promoting complex subunit 11 RING-H2 finger
  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam04564 ) U-box domain
  • ( pfam13920 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam02891 ) MIZ/SP-RING zinc finger
  • ( pfam04641 ) Replication termination factor 2
  • ( pfam09723 ) Zinc ribbon domain
  • ( pfam11793 ) FANCL C-terminal domain
  • ( pfam09774 ) Caffeine-induced death protein 2

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003105400.00000030014504373857585U-box domain containing protei
n
SGDYKL034W0.000009999254677478949TUL1 SGDID:S000001517, Chr XI
from 371829-374105, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1195.1.g74(coding)
ATGCAAGGCAAGTTTTTAATAGCTGGATTTTTCGGAATAGTTTGCATTATCATGTATTTT
AGAGGGCAATCACGAAATAATGACACTGATTCTTAAAAAGACAATGCTAAAAATAAAAAA
TAGAAAAAATCAAAAGAAAATACATTCTATGACTAAGATACATAAAGCGAAGAGGAAAGT
GTTTATGAGTGCCCAATTACTCACGAACCAATAATAATCCCTTATAAAACTCAGTGCAAT
CATGTGTTTGAAGAGAGTGCAATAACTGATTGGTTAAAGAGAGAACAGTCGTGTCCTGTC
TGCAGGAAGGCCTTGTGA


>Contig1195.1.g74(protein)
MQGKFLIAGFFGIVCIIMYFRGQSRNNDTDSQKDNAKNKKQKKSKENTFYDQDTQSEEES
VYECPITHEPIIIPYKTQCNHVFEESAITDWLKREQSCPVCRKAL