Identifiers and Description

Gene Model Identifier

Contig13376.0.g45

Standard Name

UBP1d

Aliases

Contig13376_0_g45

Description

Armadillo/beta-catenin-like repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

  • vacuolar proton-transporting V-type ATPase, V1 domain (IEA) | GO:0000221

Molecular Function

  • ATP adenylyltransferase activity (IEA) | GO:0003877
  • hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances (IEA) | GO:0016820
  • protein binding (IEA) | GO:0005515

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010162205.001531130907917e-44Armadillo/beta-catenin-like re
peat family pro...
SGDYNL189W7.00174216458014e-43SRP1 SGDID:S000005133, Chr XIV
from 284260-285888, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13376.0.g45(coding)
ATGAGGACTCGCTTCAATAAAAACCACATACCCGAACTATTCTAGTTAATATAAAGCGAA
GACCTTATTGAAAAGTACTTTGGAACAGTTGGGTTTAGACGGTTGATATGCTCTGAGACC
AAGAAACTTGTCATGAAAGATGAACAATATCAAAAAATTACGCAAATCTATGAAGCTGCC
TGGTGCATTATAAACATTGCCACAACAAAACACGTAGACCTTTTACTATCCAGATCCACT
CTCACAGGATTAGTTGCACTTTTATATTCAAAAGATGAAAAAGTTATTGAATGCAGAGAT
TTAATCATAAATGTGGGAGCAGCTCCAATTCTATGTAGAGTTATAGATAAGTCTGACCCT
ACATCTAGAATATTTAAGTAGGGGACATGGGCACTATCAAATCTATGCAGAAACAATCCA
CCTCCTGACTATAATAAACTGACTAAAGCTGTCTCAACTCTCAATAATGCATTGCTTCAT
ATAACTGAAGAGGATTACATTATAGACTTAATTTGGGCAGTATCAAAGCTAAGTAATAAA
AATGAATTTAAAGCTAAGTTTTATGAACCCGAAGGAGTAATAGACAAACTTTTAGAATTA
TCAAGTCATAAAAACTATGTTATTTCTATTCCTGCTACTAGATGTGTTGGAAATTTGTTG
GTTGAGGAAGAGGCTAAATGCTAAATTTTAATTGACAAGGGAGTAATAAATATCTTAATG
AATCAGCTTGATCATGAAAAACATGCAATCAGAAGAGAAGCATGTTGGGCTTTATCAAAT
ATCACAGCAGGGAACCATAGTTAAGTGTAGTCATTTCTTGACAGTGGAGCTCTAGATAAA
ATGATGCTTAACTTTACATATGATGATAATAAAGTCATGAAAGAAGCTGTCTATGTCATT
AATAACCTTGGGATATTTGCAACTGTCTAACAAGCAATGACAGTAATAGAAAAAGGAGTC
TTAAAAGGTTTAATAGAAATATTATAGCAGTCCGATTAAAAAACAATGACTGTAGGAATA
AGTGGAATTTATCATATCCTTAAGATAGTAAGCGACCATTACATCTAAGTTGAACAAAGG
GATAAATTCATCGAAATACTAGAAGAGCATGGCATACCATAATATCTATGTCAATGCAAG
CACACACACTCGAATCAAGTTATTTAAAAAATTGAAGATATTTTAAACGGATTCTTTAGT
GAATATTTTGAAGAGCTATAGGAATGGGAGAAAGTTAAAATTGAGGATTCTAAGCAACAT
GAGTTTAATTCAGAATTATTTTTGTTTTGA


>Contig13376.0.g45(protein)
MRTRFNKNHIPELFQLIQSEDLIEKYFGTVGFRRLICSETKKLVMKDEQYQKITQIYEAA
WCIINIATTKHVDLLLSRSTLTGLVALLYSKDEKVIECRDLIINVGAAPILCRVIDKSDP
TSRIFKQGTWALSNLCRNNPPPDYNKLTKAVSTLNNALLHITEEDYIIDLIWAVSKLSNK
NEFKAKFYEPEGVIDKLLELSSHKNYVISIPATRCVGNLLVEEEAKCQILIDKGVINILM
NQLDHEKHAIRREACWALSNITAGNHSQVQSFLDSGALDKMMLNFTYDDNKVMKEAVYVI
NNLGIFATVQQAMTVIEKGVLKGLIEILQQSDQKTMTVGISGIYHILKIVSDHYIQVEQR
DKFIEILEEHGIPQYLCQCKHTHSNQVIQKIEDILNGFFSEYFEELQEWEKVKIEDSKQH
EFNSELFLF